Human IP 10 Protein

SKU: orb426655

Description

Recombinant of human IP 10 protein

Images & Validation

• Application Notes:
  Chemokines

Key Properties

• Source: Escherichia Coli
• Protein Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA IKNLLKAVSKERSKRSP
• Purity: Greater than 95.0% as determined by SDS-PAGE.

Storage & Handling

• Storage: Stability: Lyophilized IP-10 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CXCL10 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Buffer/Preservatives: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Small inducible cytokine B10, CXCL10, 10 kDa, Gamma-IP10, IP-10, chemokine (C-X-C motif) ligand 10, C7, IFI10, INP10, crg-2, mob-1, SCYB10, gIP-10.