You have no items in your shopping cart.
Cart summary
Human IP 10 Protein
Catalog Number: orb426655
| Catalog Number | orb426655 |
|---|---|
| Category | Proteins |
| Description | Recombinant of human IP 10 protein |
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA). |
| Purity | Greater than 95.0% as determined by SDS-PAGE. |
| Protein Sequence | VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA IKNLLKAVSKERSKRSP |
| Application notes | Chemokines |
| Source | Escherichia Coli |
| Solubility (25°C) | It is recommended to reconstitute the lyophilized IP-10 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Storage | Stability: Lyophilized IP-10 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CXCL10 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
| Alternative names | Small inducible cytokine B10, CXCL10, 10 kDa, Gamm Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Human CXL10 protein (Active) [orb359056]
> 97% as determined by SDS-PAGE and HPLC.
8.6 kDa
E.Coli
5 μg, 100 μg, 500 μg - Item 1 of 1
Cynomolgus CXCL10 Protein, hFc Tag [orb1173710]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 34.8 kDa after removal of the signal peptide.The apparent molecular mass of cCXCL10-hFc is approximately 25-55 kDa due to glycosylation.
Mammalian
50 μg, 10 μg, 100 μg - Item 1 of 1
Human CXCL10 Protein, hFc Tag [orb2321426]
The purity of the protein is greater than 90% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 34.8 kDa after removal of the signal peptide.
Mammalian
50 μg, 100 μg, 10 μg - Item 1 of 1
Human CXCR3 Protein, mFc Tag [orb1290845]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 32.1 kDa after removal of the signal peptide. The apparent molecular mass of CXCR3-mFc is approximately 25-55 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μg - Item 1 of 1
Human CXCL10 protein [orb383438]
Greater than 90% as determined by SDS-PAGE.
12.6 kDa
Mammalian cell
1 mg, 20 μg, 100 μg
