Human CXL10 protein (Active)

SKU: orb359056

Description

This Human CXL10 protein (Active) spans the amino acid sequence from region 22-98aa (R93M). Purity: > 97% as determined by SDS-PAGE and HPLC.

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

• Source: E.Coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood T-lymphocytes is in a concentration range of 10- 50 ng/ml.
• Tag: Tag-Free
• Molecular Weight: 8.6 kDa
• Expression Region: 22-98aa (R93M)
• Protein Length: Full Length of Mature Protein
• Protein Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKEMSKRSP
• Purity: > 97% as determined by SDS-PAGE and HPLC.
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 µm filtered 20 mM PB, 50 mM NaCl,pH 7.4
• Disclaimer: For research use only

Alternative Names

10 kDa interferon gamma-induced protein, IP-10, Small-inducible cytokine B10, ,]

Quick Database Links

UniProt

P02778