You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb604194 |
---|---|
Category | Proteins |
Description | Recombinant Human Interleukin-6(IL6) |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Protein Sequence | VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
Protein Length | Full Length of Mature Protein |
UniProt ID | P05231 |
MW | 24.8 kDa |
Application notes | Full Length of Mature Protein |
Endotoxins | Not test. |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 30-212aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | B-cell stimulatory factor 2 , BSF-2, CTL different Read more... |
Research Area | Immunology & Inflammation |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 0.1518 - 0.3987 ng/mL.
Greater than 95% as determined by SDS-PAGE | |
22.8 kDa | |
Yeast |
> 96% as determined by SDS-PAGE and HPLC. | |
20.7 kDa | |
E.Coli |
Greater than 95% as determined by SDS-PAGE. | |
20.9 kDa | |
E.coli |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 47.9 kDa after removal of the signal peptide. | |
Mammalian |
Greater than 90% as determined by SDS-PAGE. | |
35.8 kDa | |
E.coli |