You have no items in your shopping cart.
Recombinant Human Interleukin-6 (IL6) Protein (Active)
SKU: orb1881858
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 58 - 295 pg/mL. |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 30-212aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 22.8 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE |
| Protein Sequence | VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Interleukin-6; IL-6; B-cell stimulatory factor 2 (BSF-2); CTL differentiation factor (CDF); Hybridoma growth factor; Interferon beta-2 (IFN-beta-2); IL6 ; IFNB2
Similar Products
−Recombinant human IL-6 protein (Active, HEK293) [orb1817202]
>95% as determined by SDS-PAGE
26-30 kDa
10 μg, 50 μg, 500 μgRecombinant human IL-6 protein (Active, CHO) [orb3124196]
≥ 95% as determined by SDS-PAGE.
20.8 kDa
10 μg, 50 μg, 500 μgHuman Interleukin-6 (IL6) (Active) Recombinant Protein [orb1650622]
>96% as determined by SDS-PAGE and HPLC.
20.7 kDa
1 mg, 500 μg, 250 μg, 100 μg, 20 μg, 5 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide




