Recombinant Human Interleukin-6 (IL6) Protein (Active)

SKU: orb1881858

Description

This Recombinant Human Interleukin-6 (IL6) Protein (Active) spans the amino acid sequence from region 30-212aa. Purity: Greater than 95% as determined by SDS-PAGE

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

• Source: Yeast
• Biological Origin: Homo sapiens (Human)
• Biological Activity: The ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 58 - 295 pg/mL
• Tag: N-terminal 6xHis-tagged
• Molecular Weight: 22.8 kDa
• Expression Region: 30-212aa
• Protein Length: Full Length of Mature Protein
• Protein Sequence: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
• Purity: Greater than 95% as determined by SDS-PAGE
• Endotoxins: Less than 1.0 EU/ug as determined by LAL method.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
• Disclaimer: For research use only

Alternative Names

IFNB2

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

The ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 58 - 295 pg/mL.

Quick Database Links

UniProt

P05231