You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
Recombinant Human Interleukin-6 (IL6) Protein (Active)
Catalog Number: orb1881858
| Catalog Number | orb1881858 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Interleukin-6 (IL6) Protein (Active) |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
| Purity | Greater than 95% as determined by SDS-PAGE |
| Protein Sequence | VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | P05231 |
| MW | 22.8 kDa |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
| Source | Yeast |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 58 - 295 pg/mL |
| Expression Region | 30-212aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Alternative names | IFNB2 |
| Research Area | Cancer Biology |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 58 - 295 pg/mL.
- Item 1 of 1
Human IL6 protein (Active) [orb358972]
> 96% as determined by SDS-PAGE and HPLC.
20.7 kDa
E.Coli
5 μg, 500 μg, 100 μg - Item 1 of 1
Human IL6 protein [orb594784]
Greater than 95% as determined by SDS-PAGE.
20.9 kDa
E.coli
1 mg, 500 μg, 50 μg, 10 μg - Item 1 of 1
Recombinant human IL-6 protein (Active, HEK293) [orb1817202]
>95% as determined by SDS-PAGE
26-30 kDa
10 μg, 500 μg, 50 μg 
Recombinant Human Interleukin-6 protein(IL6) (Active) [orb1650622]
5 μg, 20 μg, 100 μg, 250 μg, 1 mg, 500 μg
