Human IL6 protein

• Catalog Number: orb594784
• Category: Proteins
• Description: Recombinant Human Interleukin-6(IL6),partial (Active)
• Tag: Tag-Free
• Form/Appearance: Lyophilized powder
• Purity: Greater than 95% as determined by SDS-PAGE.
• MW: 20.9 kDa
• UniProt ID: P05231
• Protein Sequence: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
• Protein Length: Full Length of Mature Protein
• Source: E.coli
• Expression System: 29-212aa
• Biological Activity: The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is 20-100 pg/ml.
• Expression Region: 29-212aa
• Endotoxins: Less than 0.01 EU/µg as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered PBS, pH 7.4.
• Alternative names: Interleukin-6; IL-6; B-Cell Stimulatory Factor 2;
• Note: For research use only
• Application notes: Partial
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.