You have no items in your shopping cart.
Human IL6 protein
SKU: orb594784
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is 20-100 pg/ml. |
| Tag | Tag-Free |
| Molecular Weight | 20.9 kDa |
| Expression Region | 30-212aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM HAc-NaAc, 150 mM NaCl, pH 5.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Interleukin-6; IL-6; B-Cell Stimulatory Factor 2; BSF-2; CTL Differentiation Factor; CDF; Hybridoma Growth Factor; Interferon Beta-2; IFN-Beta-2; IL6; IFNB2
Similar Products
−Recombinant Human Interleukin-6 (IL6) Protein (Active) [orb1881858]
Greater than 95% as determined by SDS-PAGE
22.8 kDa
Yeast
1 mg, 100 μg, 20 μgHuman CCAAT/Enhancer Binding Protein Beta (CEBPb) ELISA Kit [orb775897]
Human
0.16-10 ng/mL
0.061 ng/mL
96 T, 48 THuman Interleukin 6 (IL-6) High Sensitivity ELISA Kit [orb1945898]
Human
0.16-10pg/mL
0.027 pg/mL
48 T, 96 T

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human IL6 protein (orb594784)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review




