You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human IL6 protein
Catalog Number: orb594784
| Catalog Number | orb594784 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Interleukin-6(IL6),partial (Active) |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM HAc-NaAc, 150 mM NaCl, pH 5.0 |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | P05231 |
| MW | 20.9 kDa |
| Application notes | Partial |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is 20-100 pg/ml. |
| Expression Region | 30-212aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Interleukin-6; IL-6; B-Cell Stimulatory Factor 2; Read more... |
| Research Area | Immunology & Inflammation |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 2
Recombinant Human Interleukin-6 (IL6) Protein (Active) [orb1881858]
Greater than 95% as determined by SDS-PAGE
22.8 kDa
Yeast
1 mg, 20 μg, 100 μg - Item 1 of 1
Human IL6 protein (Active) [orb358972]
> 96% as determined by SDS-PAGE and HPLC.
20.7 kDa
E.Coli
5 μg, 500 μg, 100 μg - Item 1 of 3
Human IL6 Protein, mFc-His Tag [orb689393]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 47.9 kDa after removal of the signal peptide.
Mammalian
50 μg, 100 μg, 10 μg - Item 1 of 2
Human IL6 protein [orb604194]
Greater than 90% as determined by SDS-PAGE.
24.8 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 2
Human CEBPD protein [orb603975]
Greater than 90% as determined by SDS-PAGE.
35.8 kDa
E.coli
100 μg, 20 μg, 1 mg
