Human IL6 protein (Active)

SKU: orb358972

Description

This Human IL6 protein (Active) spans the amino acid sequence from region 30-212aa. Purity: > 96% as determined by SDS-PAGE and HPLC.

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

• Source: E.Coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Assay #1: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using IL-6-dependent murine 7TD1 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 × 107 IU/mg. Assay #2: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using IL-6-dependent murine T1165 cells is less than 0.8 ng/ml, corresponding to a specific activity of > 1.25 ×106 IU/mg.
• Tag: Tag-Free
• Molecular Weight: 20.7 kDa
• Expression Region: 30-212aa
• Protein Length: Full Length of Mature Protein
• Protein Sequence: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENN LNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKV LIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRAL RQM
• Purity: > 96% as determined by SDS-PAGE and HPLC.
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 µm filtered PBS, pH 7.4
• Disclaimer: For research use only

Alternative Names

Interleukin BSF 2 protein, B cell differentiation factor protein, B cell stimulatory factor 2 protein, BSF 2 protein, BSF-2 protein, BSF2 protein, CDF protein, CTL differentiation factor protein, Cytotoxic T cell differentiation factor protein, HGF protein, HPGF protein, HSF protein, Hybridoma growth factor protein, Hybridoma growth factor Interferon beta-2 protein, Hybridoma plasmacytoma growth factor protein, IFN-beta-2 protein, IFNB2 protein, IL 6 protein, IL-6 protein, IL6 protein, IL6 protein protein, Interferon beta 2 protein, Interferon beta-2 protein, Interleukin 6 (interferon beta 2) protein, Interleukin 6 protein, Interleukin BSF 2 protein, Interleukin-6 protein, Interleukin6 protein

Quick Database Links

UniProt

P05231