You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb358972 |
---|---|
Category | Proteins |
Description | Recombinant human IL6 active protein |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
Purity | > 96% as determined by SDS-PAGE and HPLC. |
Protein Sequence | VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENN LNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKV LIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRAL RQM |
Protein Length | Full Length of Mature Protein |
UniProt ID | P05231 |
MW | 20.7 kDa |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Source | E.Coli |
Biological Origin | Homo sapiens (Human) |
Biological Activity | Assay #1: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using IL-6-dependent murine 7TD1 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 × 107 IU/mg. Assay #2: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using IL-6-dependent murine T1165 cells is less than 0.8 ng/ml, corresponding to a specific activity of > 1.25 ×106 IU/mg. |
Expression Region | 30-212aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | Interleukin BSF 2 protein, B cell differentiation Read more... |
Research Area | Immunology & Inflammation |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 95% as determined by SDS-PAGE | |
22.8 kDa | |
Yeast |
Greater than 95% as determined by SDS-PAGE. | |
20.9 kDa | |
E.coli |
Greater than 95% as determined by SDS-PAGE. | |
79.7 kDa | |
Mammalian cell |
>95% as determined by SDS-PAGE | |
26-30 kDa |
> 95% by SDS-PAGE analysis. | |
20.9 kDa, observed by reducing SDS-PAGE. | |
Escherichia coli. |