Human IL37 Protein

• Catalog Number: orb168595
• Category: Proteins
• Description: Recombinant of Human IL37 protein
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Purity: Greater than 95.0% as determined by SDS-PAGE.
• Solubility (25°C): It is recommended to quick spin followed by reconstitution of IL37 in PBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
• Protein Sequence: MKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD
• Source: Escherichia Coli
• Biological Activity: As measured by its binding ability in a functional ELISA, immobilized IL1F7 at 1 µg/ml (100 µl/well) can bind rhIL-18 R/Fc Chimera with a linear range of 0.015-1µg/ml.
• Storage: Stability: Lyophilized IL37 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-37 should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles
• Buffer/Preservatives: IL37 was lyophilized from a 0.2μM filtered solution of 20mM PB, 150mM NaCl and 2mM DTT pH 7.4.
• Alternative names: Interleukin-37, FIL1 zeta, IL-1X, Interleukin-1 fa
• Note: For research use only
• Application notes: Cytokines And Growth Factors
• Expiration Date: 6 months from date of receipt.