Human IL15RA protein

Catalog Number: orb594809

Catalog Number	orb594809
Category	Proteins
Description	Recombinant Human Interleukin-15 receptor subunit alpha(IL15RA),partial (Active)
Tag	C-terminal Fc-tagged
Form/Appearance	Lyophilized powder
Purity	Greater than 95% as determined by SDS-PAGE.
MW	42.2 kDa
UniProt ID	Q13261
Protein Sequence	ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIKPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT
Protein Length	Partial of Isoform 2
Source	Mammalian cell
Expression System	Expression Region: 31-172aa. Protein Length: Partial of Isoform 2
Biological Activity	The ED50 as determined by its ability to block human IL-15-induced proliferation of CTLL‑2 mouse cytotoxic T cells is 0.35-3.5 ng/ml.
Expression Region	31-205aa
Endotoxins	Less than 1.0 EU/µg as determined by LAL method.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Alternative names	CD215; IL15RA; CD215 antigen; IL-15 receptor subun Read more...
Note	For research use only
Application notes	Partial
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 44.5 kDa after removal of the signal peptide.The apparent molecular mass of IL15RA-hFc is approximately 70 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 100 μg, 10 μg, 50 μg

Purity:	Greater than 85% as determined by SDS-PAGE.
MW:	23.4 kDa
Source:	E.coli

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	Human cells