You have no items in your shopping cart.
Cart summary
Human IL15RA protein
Catalog Number: orb604889
| Catalog Number | orb604889 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Interleukin-15 receptor subunit alpha(IL15RA),partial |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| MW | 23.4 kDa |
| UniProt ID | Q13261 |
| Protein Sequence | ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT |
| Protein Length | Partial |
| Source | E.coli |
| Expression System | Expression Region: 31-205aa. Protein Length: Partial |
| Expression Region | 31-205aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | CD_antigen, CD215 Read more... |
| Note | For research use only |
| Application notes | Partial |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Human IL-15 R alpha / CD215 Protein [orb570279]
Unconjugated
95%
44.8 kDa
Human IL-15 R alpha, Fc Tag (orb570279) is expressed from human 293 cells (HEK293). It contains AA Ile 31 - Thr 205 (Accession # Q13261-1).
100 μg, 1 mg Human IL15RA Protein, hFc Tag [orb1173911]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 44.5 kDa after removal of the signal peptide.The apparent molecular mass of IL15RA-hFc is approximately 70 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μgHuman IL15 protein [orb706968]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgHuman IL15RA protein [orb391925]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgHuman IL15RA protein [orb594809]
Greater than 95% as determined by SDS-PAGE.
42.2 kDa
Mammalian cell
500 μg, 1 mg, 10 μg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars