You have no items in your shopping cart.
Human IL13 protein
SKU: orb594786
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is 1.5-4.5 ng/ml. |
| Tag | C-terminal 6xHis-tagged |
| Molecular Weight | 13.4 kDa |
| Expression Region | 25-146aa |
| Protein Length | Partial |
| Protein Sequence | GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution of PBS,PH7.4. |
| Disclaimer | For research use only |
Alternative Names
−Interleukin-13;IL-13;
Similar Products
−Human IL13 protein (Active) [orb358978]
> 97% as determined by SDS-PAGE and HPLC.
12.3 kDa
E.Coli
10 μg, 100 μg, 500 μgHuman IL13 protein (Active) [orb358979]
> 97% as determined by SDS-PAGE and HPLC.
12.5 kDa
E.Coli
10 μg, 100 μg, 500 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human IL13 protein (orb594786)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review






