You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human IL13 protein
Catalog Number: orb594786
| Catalog Number | orb594786 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Interleukin-13(IL13),partial (Active) |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution of PBS,PH7.4. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN |
| Protein Length | Partial |
| UniProt ID | AAH96139 |
| MW | 13.4 kDa |
| Application notes | Partial |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is 1.5-4.5 ng/ml. |
| Expression Region | 25-146aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Interleukin-13;IL-13; |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human IL13 protein (Active) [orb358978]
> 97% as determined by SDS-PAGE and HPLC.
12.3 kDa
E.Coli
10 μg, 100 μg, 500 μg - Item 1 of 1
Human IL13 protein (Active) [orb358979]
> 97% as determined by SDS-PAGE and HPLC.
12.5 kDa
E.Coli
500 μg, 10 μg, 100 μg - Item 1 of 3
Recombinant human IL-13RA1 protein, C-hFc (HEK293) [orb1516409]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 78-90 kDa based on Tris-Bis PAGE result.
50 μg - Item 1 of 3
Recombinant human IL-13 protein, N-His-Avi (HEK293) [orb1516421]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 15 and 25-45 kDa based on Tris-Bis PAGE result.
100 μg, 50 μg - Item 1 of 1
