Human IL13 protein

SKU: orb594786

Featured

Active

Description

This Human IL13 protein spans the amino acid sequence from region 25-146aa. Purity: Greater than 95% as determined by SDS-PAGE.

Images & Validation

−

Item 1 of 1

Application Notes	Partial

Key Properties

−

Source	Mammalian cell
Biological Origin	Homo sapiens (Human)
Biological Activity	The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is 1.5-4.5 ng/ml.
Tag	C-terminal 6xHis-tagged
Molecular Weight	13.4 kDa
Expression Region	25-146aa
Protein Length	Partial
Protein Sequence	GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxins	Less than 1.0 EU/µg as determined by LAL method.

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered solution of PBS,PH7.4.
Disclaimer	For research use only

Alternative Names

−

Interleukin-13;IL-13;

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

AAH96139

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols