You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb604185 |
---|---|
Category | Proteins |
Description | Recombinant Human Interleukin-12 subunit beta(IL12B) |
Tag | N-terminal GST-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 61.7 kDa |
UniProt ID | P29460 |
Protein Sequence | IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Expression System | Expression Region: 23-328aa. Protein Length: Full Length of Mature Protein |
Expression Region | 23-328aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Cytotoxic lymphocyte maturation factor 40KDA subun Read more... |
Note | For research use only |
Application notes | Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
36.6 kDa | |
Human IL-12B, His Tag (orb257709) is expressed from human 293 cells (HEK293). It contains AA Ile 23 - Ser 328 (Accession # P29460-1). |
Unconjugated | |
95% | |
61.3 kDa | |
Human IL-12B, Fc Tag (orb257708) is expressed from human 293 cells (HEK293). It contains AA Ile 23 - Ser 328 (Accession # AAH67499). |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
Greater than 95% as determined by SDS-PAGE. | |
39.7 kDa & 27.2 kDa | |
Mammalian cell |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 48.7 and 35.5 kDa after removal of the signal peptide. | |
Mammalian |
Filter by Rating