You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human IL12B protein
Catalog Number: orb604185
| Catalog Number | orb604185 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Interleukin-12 subunit beta(IL12B) |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | P29460 |
| MW | 61.7 kDa |
| Application notes | Full Length of Mature Protein |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 23-328aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Cytotoxic lymphocyte maturation factor 40KDA subun Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 3
Recombinant human IL-23 Alpha & mouse IL-12 Beta protein, C-His-Avi (HEK293) [orb1516411]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 50-60 (Mouse IL12 Beta) & 22 ( Human IL23 Alpha) kDa based on Tris-Bis PAGE result.
20 μg - Item 1 of 2
Human Active Protein [orb1476717]
Greater than 95% as determined by SDS-PAGE.
39.7 kDa & 27.2 kDa
Mammalian cell
1 mg, 20 μg, 100 μg - Item 1 of 1
Human IL12A and IL12B Heterodimer Protein, hFc Tag and His Tag [orb1743293]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 48.7 and 35.5 kDa after removal of the signal peptide.
Mammalian
50 μg, 10 μg, 100 μg - Item 1 of 1
Human IL23A and IL12B Heterodimer Protein, hFc Tag and His Tag [orb1743335]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 44.8 and 35.5 kDa after removal of the signal peptide. The apparent molecular mass of IL23A-hFc and IL12B-His is approximately 35-55 kDa due to glycosylation.
E.coli
10 μg, 50 μg, 100 μg - Item 1 of 1
Human IL12B Protein, His Tag [orb1290821]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 35.5 kDa after removal of the signal peptide. The apparent molecular mass of IL12B-His is approximately 35-55 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μg
