Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Human Active Protein

SKU: orb1476717
ActiveBiologically Active

Description

This Human Active Protein spans the amino acid sequence from region 23-328aa(IL12B) & 23-219aa(IL12A). Purity: Greater than 95% as determined by SDS-PAGE.

Research Area

Immunology & Inflammation

Images & Validation

Application Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

SourceMammalian cell
Biological OriginHomo sapiens (Human)
Biological ActivityMeasured by its binding ability in a functional ELISA. Immobilized Human IL12B&IL12A at 1 μg/ml/mL can bind Anti-IL12/IL23 recombinant antibody, the EC50 is 1.042-1.545 ng/mL.
TagC-terminal 10xHis-tagged & C-terminal Flag-tagged
Expression Region23-328aa(IL12B)&23-219aa(IL12A)
Protein LengthHeterodimer
EndotoxinsLess than 1.0 EU/μg as determined by LAL method.
MW39.7 kDa & 27.2 kDa
PurityGreater than 95% as determined by SDS-PAGE.
Protein SequenceIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS&RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

Storage & Handling

StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

(Cytotoxic lymphocyte maturation factor)(CLMF)(IL-12)(NK cell stimulatory factor)(NKSF)

Similar Products

  • SERAC1 Rabbit Polyclonal Antibody [orb1402098]

    ELISA,  FC,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Active Caspase 3 Mouse mAb [orb500767]

    ELISA,  IF,  IHC-Fr,  IHC-P,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Mouse

    Monoclonal

    Unconjugated

  • Recombinant Human Complement C5 (Active) [orb3155656]

    Greater than 90% as determined by SDS-PAGE.

    188.0 kDa

    Mammalian cell

    1 mg, 100 μg, 20 μg
  • Recombinant Human Claudin-3 (CLDN3)-VLPs (Active) [orb1674366]

    24.7 kDa

    Mammalian cell

    1 mg, 100 μg, 20 μg
  • Recombinant Human Interleukin-6 (IL6) Protein (Active) [orb1881858]

    Greater than 95% as determined by SDS-PAGE

    22.8 kDa

    Yeast

    1 mg, 100 μg, 20 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Human Active Protein

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Human Active Protein

Measured by its binding ability in a functional ELISA. Immobilized Human IL12B&IL12A at 1 μg/ml/mL can bind Anti-IL12/IL23 recombinant antibody, the EC50 is 1.042-1.545 ng/mL.

UniProt Details

No UniProt data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Human Active Protein (orb1476717)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

20 μg
$ 280.00
100 μg
$ 470.00
1 mg
$ 3,190.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry