Cart summary

You have no items in your shopping cart.

Human Active Protein

Catalog Number: orb1476717

Select Product Size
SizePriceQuantity
20 μg$ 310.00
100 μg$ 470.00
1 mg$ 2,960.00
20 μg Enquire
100 μg Enquire
1 mg Enquire
DispatchUsually dispatched within 5-10 working days
Product Properties
Catalog Numberorb1476717
CategoryProteins
DescriptionRecombinant Human IL12B&IL12A Heterodimer Protein (Active)
TagC-terminal 10xHis-tagged & C-terminal Flag-tagged
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
PurityGreater than 95% as determined by SDS-PAGE.
Protein SequenceIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS&RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
Protein LengthHeterodimer
UniProt IDP29459, P29460
MW39.7 kDa & 27.2 kDa
Application notesWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
EndotoxinsLess than 1.0 EU/ug as determined by LAL method.
SourceMammalian cell
Biological OriginHomo sapiens (Human)
Biological ActivityMeasured by its binding ability in a functional ELISA. Immobilized Human IL12B&IL12A at 1 μg/ml/mL can bind Anti-IL12/IL23 recombinant antibody, the EC50 is 1.042-1.545 ng/mL.
Expression Region23-328aa(IL12B) & 23-219aa(IL12A)
StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Alternative names(Cytotoxic lymphocyte maturation factor)(CLMF)(IL-
Read more...
Research AreaImmunology & Inflammation
NoteFor research use only
Expiration Date6 months from date of receipt.
Images
Human Active Protein

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Human Active Protein

Measured by its binding ability in a functional ELISA. Immobilized Human IL12B&IL12A at 1 μg/ml/mL can bind Anti-IL12/IL23 recombinant antibody, the EC50 is 1.042-1.545 ng/mL.

Similar Products
  • Human CCR8 protein [orb865263]

    42.2 kDa

    Mammalian cell

    1 mg, 100 μg, 20 μg
  • Human MS4A1-VLPs Protein [orb1478133]

    34.4 kDa

    Mammalian cell

    20 μg, 100 μg, 1 mg
  • Recombinant Human Claudin-3 (CLDN3)-VLPs (Active) [orb1674366]

    24.7 kDa

    Mammalian cell

    1 mg, 20 μg, 100 μg
  • Human IL17A Protein [orb1476713]

    Greater than 95% as determined by SDS-PAGE.

    15.9 kDa

    Baculovirus

    100 μg, 20 μg, 1 mg
  • Human CLDN6-VLPs Protein [orb1478125]

    25.1 kDa

    Mammalian cell

    20 μg, 1 mg, 100 μg
Reviews

Human Active Protein (orb1476717)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet