You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb419321 |
---|---|
Category | Proteins |
Description | Recombinant Human Interleukin-12 subunit alpha active |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Purity | > 95% as determined by SDS-PAGE and HPLC. |
MW | 57.2 kDa. 75.0 kDa is the observed value of non-reducing gel,and the reducing glue is the size of p40 and p35 subunits, and 57.2 kDa is the theoretical value. |
UniProt ID | P29459 |
Protein Sequence | p35Subunit:RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASp40Subunit:IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS |
Protein Length | Full Length of Mature Protein |
Source | Baculovirus |
Biological Origin | Homo sapiens (Human) |
Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using PHA-activated human T lymphoblasts is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 × 107 IU/mg. |
Expression Region | 23-219aa&23-328aa |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
Alternative names | IL-12A, CLMF p35, IL-12 subunit p35, NK cell stimu Read more... |
Background | Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated Killer cells, and stimulate the production of IFN-gamma by resting PBMC. |
Note | For research use only |
Application notes | Tag Info: NO-taggedExpression Region: 23-219aa&23-328aaSequence Info: Partial |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
90% | |
49.2 kDa | |
Human IL-12A, Fc Tag (orb257707) is expressed from human 293 cells (HEK293). It contains AA Arg 23 - Ser 219 (Accession # P29459). |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 48.7 and 35.5 kDa after removal of the signal peptide. | |
Mammalian |
Greater than 95% as determined by SDS-PAGE. | |
39.7 kDa & 27.2 kDa | |
Mammalian cell |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
Unconjugated | |
Greater than 95% as determined by reducing SDS-PAGE. | |
22.5and34.7 KDa | |
Mammalian |
Filter by Rating