Cart summary

You have no items in your shopping cart.

    Human IL12A protein

    Catalog Number: orb419321

    DispatchUsually dispatched within 1-2 weeks
    $ 4,390.00
    Catalog Numberorb419321
    CategoryProteins
    DescriptionRecombinant Human Interleukin-12 subunit alpha active
    TagTag-Free
    Form/AppearanceLyophilized powder
    Purity> 95% as determined by SDS-PAGE and HPLC.
    MW57.2 kDa. 75.0 kDa is the observed value of non-reducing gel,and the reducing glue is the size of p40 and p35 subunits, and 57.2 kDa is the theoretical value.
    UniProt IDP29459
    Protein Sequencep35Subunit:RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASp40Subunit:IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
    Protein LengthFull Length of Mature Protein
    SourceBaculovirus
    Biological OriginHomo sapiens (Human)
    Biological ActivityFully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using PHA-activated human T lymphoblasts is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 × 107 IU/mg.
    Expression Region23-219aa&23-328aa
    EndotoxinsLess than 1.0 EU/µg as determined by LAL method.
    StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
    Buffer/PreservativesLyophilized from a 0.2 µm filtered PBS, pH 7.4
    Alternative namesIL-12A, CLMF p35, IL-12 subunit p35, NK cell stimu
    Read more...
    BackgroundCytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated Killer cells, and stimulate the production of IFN-gamma by resting PBMC.
    NoteFor research use only
    Application notesTag Info: NO-taggedExpression Region: 23-219aa&23-328aaSequence Info: Partial
    Expiration Date6 months from date of receipt.
    Human IL12A protein

    • Human IL-12A / NKSF1 / p35 Protein [orb257707]

      Unconjugated

      90%

      49.2 kDa

      Human IL-12A, Fc Tag (orb257707) is expressed from human 293 cells (HEK293). It contains AA Arg 23 - Ser 219 (Accession # P29459).

      500 μg, 50 μg
    • Human IL12A and IL12B Heterodimer Protein, hFc Tag and His Tag [orb1743293]

      Unconjugated

      The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.

      The protein has a predicted molecular mass of 48.7 and 35.5 kDa after removal of the signal peptide.

      Mammalian

      10 μg, 50 μg, 100 μg
    • Human Active Protein [orb1476717]

      Greater than 95% as determined by SDS-PAGE.

      39.7 kDa & 27.2 kDa

      Mammalian cell

      20 μg, 100 μg, 1 mg
    • Human IL12A protein [orb391915]

      ELISA,  MS,  SDS-PAGE,  WB

      Greater than 95% as determined by reducing SDS-PAGE.

      Human cells

      500 μg, 50 μg, 10 μg
    • Human IL-12 Protein [orb1471767]

      Unconjugated

      Greater than 95% as determined by reducing SDS-PAGE.

      22.5and34.7 KDa

      Mammalian

      10 μg, 50 μg
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars