Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Human IL12A protein

SKU: orb419321
ActiveBiologically Active

Description

This Human IL12A protein spans the amino acid sequence from region 23-219aa&23-328aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Research Area

Immunology & Inflammation

Images & Validation

Application Notes
Tag Info: NO-taggedExpression Region: 23-219aa&23-328aaSequence Info: Partial

Key Properties

SourceBaculovirus
Biological OriginHomo sapiens (Human)
Biological ActivityMeasured in a cell proliferation assay using PHA-stimulated human T lymphoblasts. The ED50 for this effect is 0.01-0.05 ng/mL. The specific activity of rHuIL-12 is approximately 1.1 × 104 units/μg, which is calibrated against
TagTag-Free
Expression Region23-219aa&23-328aa
Protein LengthHeterodimer
EndotoxinsLess than 1.0 EU/μg as determined by LAL method.
MW57.2 kDa. 75.0 kDa is the observed value of non-reducing gel,and the reducing glue is the size of p40 and p35 subunits, and 57.2 kDa is the theoretical value.
Purity> 95% as determined by SDS-PAGE and HPLC.
Protein Sequencep35Subunit:RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASp40Subunit:IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Storage & Handling

StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized from a 0.2 µm filtered PBS, pH 7.4
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

IL-12A, CLMF p35, IL-12 subunit p35, NK cell stimulatory factor chain 1, NKSF1

Similar Products

  • IL12A Antibody [orb401620]

    ELISA,  IHC

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
  • Human Active Protein [orb1476717]

    Greater than 95% as determined by SDS-PAGE.

    39.7 kDa & 27.2 kDa

    Mammalian cell

    100 μg, 20 μg, 1 mg
  • IL12A/IL-12 p35/NKSF1 Mouse Monoclonal Antibody [orb2974723]

    ELISA,  FC

    Human

    Mouse

    Monoclonal

    Unconjugated

    50 μg, 100 μg
  • Human IL-12(p70) ELISA Kit [orb50058]

    Human

    7.8 pg/ml - 500 pg/ml

    <2 pg/ml

    96 T
  • Human IL12A and IL12B Heterodimer Protein, hFc Tag and His Tag [orb1743293]

    Unconjugated

    The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.

    The protein has a predicted molecular mass of 48.7 and 35.5 kDa after removal of the signal peptide.

    Mammalian

    10 μg, 50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

10 μg
$ 410.00
100 μg
$ 2,150.00
500 μg
$ 4,760.00
DispatchUsually dispatched within 1-2 weeks
Bulk Enquiry