You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb429395 |
---|---|
Category | Tools |
Description | Recombinant of human IL1 alpha protein |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
Purity | Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Solubility (25°C) | It is recommended to reconstitute the lyophilized Interleukin 1 alpha in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Protein Sequence | SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAV KFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITG SETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILE NQA |
Source | Escherichia Coli |
Biological Activity | The ED50 as determined by the dose-dependant stimulation of murine D10S cells is < 0.001 ng/ml, corresponding to a Specific Activity of 1 x 109 IU/mg. |
Storage | Stability: Lyophilized Interleukin-1 alpha although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-1a should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles |
Buffer/Preservatives | The protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 25mM Tris-HCl, pH 8. |
Alternative names | Hematopoietin-1, Lymphocyte-activating factor (LAF Read more... |
Note | For research use only |
Application notes | Protein content: Protein quantitation was carried out by two independent methods:1. UV spectroscopy at 280 nm using the absorbency value of 1.13 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics). 2. Analysis by RP-HPLC, using a standard solution of IL-1 as a Reference Standard |
Expiration Date | 12 months from date of receipt. |
Unconjugated | |
90% | |
39.0 kDa | |
Human IL-13 R alpha 2, His Tag (orb612134) is expressed from human 293 cells (HEK293). It contains AA Asp 27 - Arg 343 (Accession # Q14627-1). |
Unconjugated | |
95% | |
39.4 kDa | |
Human IL-6 R alpha, His Tag (orb257625) is expressed from human 293 cells (HEK293). It contains AA Leu 20 - Pro 365 (Accession # NP_000556.1). |
> 97% as determined by SDS-PAGE and HPLC. | |
18.0 kDa | |
E.Coli |
Unconjugated | |
90% | |
37.7 kDa | |
Human IL-13 R alpha 1 Protein, His Tag (orb257580) is expressed from human 293 cells (HEK293). It contains AA Gly 22 - Thr 343 (Accession # NP_001551.1). |
Unconjugated | |
95% | |
62.7 kDa | |
Mouse IL-13RA1, Fc Tag (orb257586) is expressed from human 293 cells (HEK293). It contains AA Ala 26 - Thr 340 (Accession # NP_598751). |
Filter by Rating