Human IHH protein (Active)

SKU: orb359262

Description

This Human IHH protein (Active) spans the amino acid sequence from region 29-202aa. Purity: > 96% as determined by SDS-PAGE and HPLC.

Research Area

Cell Biology

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  Read more...

Key Properties

• Source: E.Coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by its ability to induce alkaline phosphatase production by C3H10T1/2(CCL-226) cells is 3.0-10 μg/ml.
• Tag: Tag-Free
• Expression Region: 29-202aa
• Protein Length: Partial
• Endotoxins: Less than 1.0 EU/μg as determined by LAL method.
• MW: 19.8 kDa
• Purity: > 96% as determined by SDS-PAGE and HPLC.
• Protein Sequence: II+GPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGG

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 1 × PBS, pH 7.4
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

IHH,

Quick Database Links

UniProt

Q14623