Human IGF1 protein

SKU: orb594726

Description

This Human IGF1 protein spans the amino acid sequence from region 52-118aa. Purity: Greater than 95% as determined by SDS-PAGE.

Images & Validation

• Application Notes:
  Partial

Key Properties

• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: The ED50 as determined in a serum-free cell proliferation assay using MCF‑7 human breast cancer cells is 20-100 ng/ml.
• Tag: Tag-Free
• Molecular Weight: 7.3 kDa
• Expression Region: 52-118aa
• Protein Length: Partial
• Protein Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
• Purity: Greater than 95% as determined by SDS-PAGE.
• Endotoxins: Less than 0.5 EU/µg as determined by LAL method.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM NaAc-HAC, pH 4.5
• Disclaimer: For research use only

Alternative Names

Insulin-Like Growth Factor I; IGF-I; Mechano Growth Factor; MGF; Somatomedin-C; IGF1; IBP1

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

P05019