Human IGF1 protein

Catalog Number: orb594726

Catalog Number	orb594726
Category	Proteins
Description	Recombinant Human Insulin-like growth factor I(IGF1),partial (Active)
Tag	Tag-Free
Form/Appearance	Lyophilized powder
Purity	Greater than 95% as determined by SDS-PAGE.
MW	7.3 kDa
UniProt ID	P05019
Protein Sequence	TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Protein Length	Partial
Source	E.coli
Expression System	Expression Region: 52-118aa. Protein Length: Partial
Biological Activity	The ED50 as determined in a serum-free cell proliferation assay using MCF‑7 human breast cancer cells is 20-100 ng/ml.
Expression Region	52-118aa
Endotoxins	Less than 0.5 EU/µg as determined by LAL method.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered 20 mM NaAc-HAC, pH 4.5
Alternative names	Insulin-Like Growth Factor I; IGF-I; Mechano Growt Read more...
Note	For research use only
Application notes	Partial
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	90%
MW:	30.6 kDa
Source:	Human IGFBP-3, His Tag (orb1146966) is expressed from human 293 cells (HEK293). It contains AA Gly 28 - Lys 291 (Accession # P17936-1).

Applications:	ELISA, FA, HPLC, SDS-PAGE, WB
Conjugation:	Unconjugated
Purity:	> 95% pure by SDS-PAGE and HPLC analyses.
MW:	9.1 kDa

Purity:	> 97% as determined by SDS-PAGE and HPLC.
MW:	7.4 kDa
Source:	E.Coli