You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human IGF1 protein
Catalog Number: orb594726
| Catalog Number | orb594726 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Insulin-like growth factor I(IGF1),partial (Active) |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 7.3 kDa |
| UniProt ID | P05019 |
| Protein Sequence | TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Protein Length | Partial |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a serum-free cell proliferation assay using MCF‑7 human breast cancer cells is 20-100 ng/ml. |
| Expression Region | 52-118aa |
| Endotoxins | Less than 0.5 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM NaAc-HAC, pH 4.5 |
| Alternative names | Insulin-Like Growth Factor I; IGF-I; Mechano Growt Read more... |
| Note | For research use only |
| Application notes | Partial |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human IGF-I R Protein, Fc Tag [orb1496214]
Unconjugated
95%
129.3 kDa
Human IGF-I R, Fc Tag (orb1496214) is expressed from human 293 cells (HEK293). It contains AA Glu 31 - Asn 932 (Accession # P08069-1).
100 μg, 1 mg - Item 1 of 3
Human IGF-I (67AA) Protein [orb1471761]
Greater than 95% as determined by reducing SDS-PAGE.
7.3 KDa
Mammalian
10 μg, 50 μg - Item 1 of 3
Human IGF1 protein [orb604720]
Greater than 90% as determined by SDS-PAGE.
34.7 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 4
Human LR3IGF1 protein [orb82618]
ELISA, FA, HPLC, SDS-PAGE, WB
Unconjugated
> 95% pure by SDS-PAGE and HPLC analyses.
9.1 kDa
5 mg, 20 mg, 1 mg - Item 1 of 3
Recombinant human IGF1R protein, C-His-Avi (HEK293) [orb1516429]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 110-120 (Alpha subunit) and 52-55 (Beta subunit) kDa based on Tris-Bis PAGE result.
100 μg, 50 μg
