Human IGF1 protein

• Catalog Number: orb604720
• Category: Proteins
• Description: Recombinant Human Insulin-like growth factor I(IGF1)
• Tag: N-terminal GST-tagged
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
• Protein Length: Full Length of Mature Protein
• UniProt ID: P05019
• MW: 34.7 kDa
• Application notes: Full Length of Mature Protein
• Endotoxins: Not test.
• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Expression Region: 49-118aa
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Alternative names: Mechano growth factor , MGFSomatomedin-C
• Note: For research use only

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IGF1.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IGF1.