You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
Human ICOSLG protein
Catalog Number: orb705334
| Catalog Number | orb705334 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human ICOS ligand(ICOSLG),partial |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Purity | Greater than 93% as determined by SDS-PAGE. |
| Protein Sequence | DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWS |
| Protein Length | Partial |
| UniProt ID | O75144 |
| MW | 28.9 kDa |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized ICOSLG at 2 μg/ml can bind human ICOS, the EC50 of human ICOSLG protein is 29.04-43.59 ng/ml. |
| Expression Region | 19-258aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | B7 homolog 2 (B7-H2) (B7-like protein Gl50) (B7-re Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized ICOSLG at 2 μg/ml can bind human ICOS, the EC50 of human ICOSLG protein is 29.04-43.59 ng/ml.
- Item 1 of 2
Human B7-H2 Protein, mFc-His Tag [orb689390]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 53.9 kDa after removal of the signal peptide.
Mammalian
100 μg, 50 μg, 10 μg - Item 1 of 1
Mouse B7-H2 Protein, hFc Tag [orb1290894]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 52.4 kDa after removal of the signal peptide. The apparent molecular mass of mB7-H2-hFc is approximately 55-70 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μg - Item 1 of 1
Recombinant Human ICOS ligand (ICOSLG), partial [orb2658139]
Greater than 95% as determined by SDS-PAGE.
30.7 kDa
Mammalian cell
20 μg, 100 μg, 1 mg 
- Item 1 of 1
