Human ICOSLG protein

SKU: orb705334

Featured

Description

This Human ICOSLG protein spans the amino acid sequence from region 19-258aa. Purity: Greater than 93% as determined by SDS-PAGE.

Images & Validation

−

Item 1 of 2

Application Notes	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

−

Source	Mammalian cell
Biological Origin	Homo sapiens (Human)
Biological Activity	Measured by its binding ability in a functional ELISA. Immobilized ICOSLG at 2 μg/ml can bind human ICOS, the EC50 of human ICOSLG protein is 29.04-43.59 ng/ml.
Tag	C-terminal 6xHis-tagged
Molecular Weight	28.9 kDa
Expression Region	19-258aa
Protein Length	Partial
Protein Sequence	DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWS
Purity	Greater than 93% as determined by SDS-PAGE.
Endotoxins	Less than 1.0 EU/ug as determined by LAL method.

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Disclaimer	For research use only

Alternative Names

−

B7 homolog 2 (B7-H2) (B7-like protein Gl50) (B7-related protein 1) (B7RP-1)

Human B7-H2 Protein, mFc-His Tag [orb689390]

Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 53.9 kDa after removal of the signal peptide.
Source:	Mammalian

Sizes Available: 100 μg, 50 μg, 10 μg

Item 1 of 1

Mouse B7-H2 Protein, hFc Tag [orb1290894]

Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 52.4 kDa after removal of the signal peptide. The apparent molecular mass of mB7-H2-hFc is approximately 55-70 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 100 μg, 10 μg, 50 μg

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized ICOSLG at 2 μg/ml can bind human ICOS, the EC50 of human ICOSLG protein is 29.04-43.59 ng/ml.

Quick Database Links

UniProt

O75144

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols