You have no items in your shopping cart.
Human HMGB1 Protein
SKU: orb168504
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Protein Sequence | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERW KTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPS AFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLK EKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEED EDEEEDDDDELEHHHHHH |
| Purity | Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Storage & Handling
−| Storage | Stability: Lyophilized HMGB1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution HMGB1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | The HMG1 (1mg/ml) was lyophilized after extensive dialyses against 1x PBS pH-7.4. |
| Disclaimer | For research use only |
Alternative Names
−HMG1, HMG3, SBP-1, Amphoterin, HMGB1, High-Mobility Group Box 1.
Similar Products
−Human High Mobility Group Protein B1 (HMGB-1) ELISA Kit [orb1807472]
Human
31.25-2000pg/mL
13.7 pg/mL
96 T, 48 THuman High Mobility Group Protein B1 (HMGB-1) ELISA Kit [orb775302]
Human
62.5-4000 pg/mL
26.9 pg/mL
96 T, 48 T

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human HMGB1 Protein (orb168504)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review













