Human gp120 protein

SKU: orb244744

Description

This Human gp120 recombinant protein spans the amino acid sequence from region 33-511aa. The calculated molecular weight for this env protein is 69.7 kDa. This env protein is produced using e.coli expression system. The N-terminal 6xHis-SUMO tag was smoothly integrated into the coding gene of env, which enables a simple process of detecting and purifying the env recombinant protein in the following steps.

Research Area

Apoptotic, Cancer, Epigenetics, Infectious Diseases, Neuroscience, Non-Animal, Signaling Pathways

Key Properties

• Source: E.coli
• Biological Origin: Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1)
• Tag: N-terminal 6xHis-SUMO-tagged
• Expression Region: 33-511aa
• Protein Length: Partial
• MW: 69.7 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: KLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLVNVTENFNMWKNDMVEQMHEDIISLWDQSLKPCVKLTPLCVSLKCTDLKNDTNTNSSSGRMIMEKGEIKNCSFNISTSIRGKVQKEYAFFYKLDIIPIDNDTTSYKLTSCNTSVITQACPKVSFEPIPIHYCAPAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSVNFTDNAKTIIVQLNTSVEINCTRPNNNTRKRIRIQRGPGRAFVTIGKIGNMRQAHCNISRAKWNNTLKQIASKLREQFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFNSTWFNSTWSTEGSNNTEGSDTITLPCRIKQIINMWQKVGKAMYAPPISGQIRCSSNITGLLLTRDGGNSNNESEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQREKR

Storage & Handling

• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Envelope glycoprotein gp160; Env polyprotein

Quick Database Links

UniProt

P04578