You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb246137 |
---|---|
Category | Proteins |
Description | Recombinant human cytomegalovirus (strain Merlin) (HHV-5) (human herpesvirus 5) Envelope glycoprotein L |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 29.5 kDa |
UniProt ID | F5HCH8 |
Protein Sequence | AAVSVAPTAAEKVPAECPELTRRCLLGEVFEGDKYESWLRPLVNVTGRDGPLSQLIRYRPVTPEAANSVLLDEAFLDTLALLYNNPDQLRALLTLLSSDTAPRWMTVMRGYSECGDGSPAVYTCVDDLCRGYDLTRLSYGRSIFTEHVLGFELVPPSLFNVVVAIRNEATRTNRAVRLPVSTAAAPEGITLFYGLYNAVKEFCLRHQLDPPLLRHLDKYYAGLPPELKQTRVNLPAHSRYGPQAVDAR |
Protein Length | Full Length of Mature Protein |
Source | Yeast |
Expression System | Expression Region: 31-278aa. Protein Length: Full Length of Mature Protein |
Expression Region | 31-278aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | gL Read more... |
Note | For research use only |
Application notes | This is His-tag protein |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
90% | |
104.0 kDa | |
HCMV Glycoprotein B (gB) Protein, Fc Tag (orb257973) Val 23 - Lys 700 (Accession # P13201-1) with furin cleavage site mutated from 'RTKR' to 'TTQT', was produced in human 293 cells (HEK293) at ACROBiosystems. |
Greater than 90% as determined by SDS-PAGE. | |
57.5 kDa | |
E.coli |
Greater than 85% as determined by SDS-PAGE. | |
20.5 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
15.1 kDa | |
Yeast |
Greater than 85% as determined by SDS-PAGE. | |
16.9 kDa | |
Baculovirus |
Filter by Rating