You have no items in your shopping cart.
Page Not Found
Cart summary
Item 1 of 1
Human gL protein
Catalog Number: orb246137
| Catalog Number | orb246137 |
|---|---|
| Category | Proteins |
| Description | Recombinant human cytomegalovirus (strain Merlin) (HHV-5) (human herpesvirus 5) Envelope glycoprotein L |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 29.5 kDa |
| UniProt ID | F5HCH8 |
| Protein Sequence | AAVSVAPTAAEKVPAECPELTRRCLLGEVFEGDKYESWLRPLVNVTGRDGPLSQLIRYRPVTPEAANSVLLDEAFLDTLALLYNNPDQLRALLTLLSSDTAPRWMTVMRGYSECGDGSPAVYTCVDDLCRGYDLTRLSYGRSIFTEHVLGFELVPPSLFNVVVAIRNEATRTNRAVRLPVSTAAAPEGITLFYGLYNAVKEFCLRHQLDPPLLRHLDKYYAGLPPELKQTRVNLPAHSRYGPQAVDAR |
| Protein Length | Full Length of Mature Protein |
| Source | Yeast |
| Biological Origin | Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5) |
| Expression Region | 31-278aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | gL Read more... |
| Note | For research use only |
| Application notes | This is His-tag protein |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 3
Human Envelope glycoprotein L protein [orb419357]
Greater than 90% as determined by SDS-PAGE.
42.7 kDa
E.coli
100 μg, 20 μg, 1 mg - Item 1 of 2
Human GCGR full length protein-synthetic nanodisc [orb1743186]
The human full length GCGR protein has a MW of 54.0 kDa
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 2
Human GCGR protein [orb605217]
Greater than 95% as determined by SDS-PAGE.
18.1 kDa
Mammalian cell
20 μg, 100 μg, 1 mg - Item 1 of 2
Human GCGR Protein, hFc Tag [orb1290961]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 39.2 kDa after removal of the signal peptide. The apparent molecular mass of GCGR-hFc is approximately 55-70 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μg - Item 1 of 1
Human GCGR protein [orb594980]
Greater than 85% as determined by SDS-PAGE.
16.9 kDa
Baculovirus
1 mg, 20 μg, 100 μg
