Human GHR protein

• Catalog Number: orb705333
• Category: Proteins
• Description: Recombinant Human Growth hormone receptor(GHR),partial
• Tag: C-terminal hFc-tagged
• Form/Appearance: Lyophilized powder
• Purity: Greater than 90% as determined by SDS-PAGE.
• MW: 58.8 kDa
• UniProt ID: P10912
• Protein Sequence: AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY
• Protein Length: Partial
• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Expression Region: 27-264aa
• Endotoxins: Less than 1.0 EU/ug as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
• Alternative names: Somatotropin receptor (Serum-binding protein)
• Note: For research use only
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized GH1 at 1 μg/ml can bind human GHR, the EC50 of human GHR protein is 24.96-33.39 ng/ml.

Human GH1 protein his/myc tag captured on COOH chip can bind Human GHR protein Fc tag with an affinity constant of 6.1 nM as detected by LSPR Assay.

The purity of GHR was greater than 95% as determined by SEC-HPLC