You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | ①Measured by its binding ability in a functional ELISA. Immobilized GH1 at 1 μg/ml can bind human GHR, the EC50 of human GHR protein is 24.96-33.39 ng/ml. ②Human GH1 protein his/myc tag captured on COOH chip can bind Human GHR protein Fc tag with an affinity constant of 6.1 nM as detected by LSPR Assay. |
| Tag | C-terminal hFc1-tagged |
| Expression Region | 27-264aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 58.8 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human GHR protein [orb10083]
Greater than 90% as determined by SDS-PAGE.
44.4 kDa
E.coli
100 μg, 20 μg, 1 mgHuman GHR Protein, hFc Tag [orb1173826]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 53.8 kDa after removal of the signal peptide. The apparent molecular mass of GHR-hFc is approximately 55-100 kDa due to glycosylation.
Mammalian
50 μg, 10 μg, 100 μgGrowth hormone receptor/GHR Rabbit Polyclonal Antibody [orb623864]
ELISA, FC, ICC, IF, IHC, WB
Human
Rabbit
Polyclonal
Unconjugated
100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized GH1 at 1 μg/ml can bind human GHR, the EC50 of human GHR protein is 24.96-33.39 ng/ml.

Human GH1 protein his/myc tag captured on COOH chip can bind Human GHR protein Fc tag with an affinity constant of 6.1 nM as detected by LSPR Assay.

The purity of GHR was greater than 95% as determined by SEC-HPLC
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human GHR protein (orb705333)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review










