Human GCGR protein

• Catalog Number: orb605217
• Category: Proteins
• Description: Recombinant Human Glucagon receptor(GCGR),partial
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Purity: Greater than 95% as determined by SDS-PAGE.
• Protein Sequence: AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK
• Protein Length: Partial
• UniProt ID: P47871
• MW: 18.1 kDa
• Application notes: Partial
• Endotoxins: Less than 1.0 EU/ug as determined by LAL method.
• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized human GCGR at 2 μg/mL can bind Anti-GCGR recombinant antibody, the EC50 is 3.747-6.666 ng/mL.
• Expression Region: 26-136aa
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Alternative names: (GL-R)
• Research Area: Cancer Biology
• Note: For research use only
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized human GCGR at 2 μg/ml can bind Anti-GCGR recombinant antibody, the EC50 is 3.747-6.666 ng/mL.