You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb605217 |
---|---|
Category | Proteins |
Description | Recombinant Human Glucagon receptor(GCGR),partial |
Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 18.1 kDa |
UniProt ID | P47871 |
Protein Sequence | AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK |
Protein Length | Partial |
Source | Mammalian cell |
Expression System | Expression Region: 26-136aa. Protein Length: Partial |
Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized human GCGR at 2 μg/mL can bind Anti-GCGR recombinant antibody (CSB-RA009316A1HU), the EC50 is 3.747-6.666 ng/mL. |
Expression Region | 26-136aa |
Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Alternative names | (GL-R) Read more... |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
Greater than 85% as determined by SDS-PAGE. | |
20.5 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
15.1 kDa | |
Yeast |
Greater than 85% as determined by SDS-PAGE. | |
16.9 kDa | |
Baculovirus |
The human full length GCGR protein has a MW of 54.0 kDa | |
Mammalian |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 39.2 kDa after removal of the signal peptide. The apparent molecular mass of GCGR-hFc is approximately 55-70 kDa due to glycosylation. | |
Mammalian |
Filter by Rating