You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb605217 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Glucagon receptor(GCGR),partial |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK |
| Protein Length | Partial |
| UniProt ID | P47871 |
| MW | 18.1 kDa |
| Application notes | Partial |
| Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized human GCGR at 2 μg/mL can bind Anti-GCGR recombinant antibody, the EC50 is 3.747-6.666 ng/mL. |
| Expression Region | 26-136aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | (GL-R) |
| Research Area | Cancer Biology |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized human GCGR at 2 μg/ml can bind Anti-GCGR recombinant antibody, the EC50 is 3.747-6.666 ng/mL.
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 39.2 kDa after removal of the signal peptide. The apparent molecular mass of GCGR-hFc is approximately 55-70 kDa due to glycosylation. | |
Mammalian |
The human full length GCGR protein has a MW of 54.0 kDa | |
Mammalian |
Greater than 85% as determined by SDS-PAGE. | |
20.5 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
15.1 kDa | |
Yeast |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review