You have no items in your shopping cart.
Cart summary
Human GCGR protein
Catalog Number: orb605217
| Catalog Number | orb605217 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Glucagon receptor(GCGR),partial |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 18.1 kDa |
| UniProt ID | P47871 |
| Protein Sequence | AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK |
| Protein Length | Partial |
| Source | Mammalian cell |
| Expression System | Expression Region: 26-136aa. Protein Length: Partial |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized human GCGR at 2 μg/mL can bind Anti-GCGR recombinant antibody (CSB-RA009316A1HU), the EC50 is 3.747-6.666 ng/mL. |
| Expression Region | 26-136aa |
| Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Alternative names | (GL-R) Read more... |
| Note | For research use only |
| Application notes | Partial |
| Expiration Date | 6 months from date of receipt. |
Human GCGR protein [orb604115]
Greater than 85% as determined by SDS-PAGE.
20.5 kDa
E.coli
20 μg, 100 μg, 1 mgHuman GCGR protein [orb605329]
Greater than 90% as determined by SDS-PAGE.
15.1 kDa
Yeast
100 μg, 20 μg, 500 μg, 1 mgHuman GCGR protein [orb594980]
Greater than 85% as determined by SDS-PAGE.
16.9 kDa
Baculovirus
20 μg, 100 μg, 500 μg, 1 mgHuman GCGR full length protein-synthetic nanodisc [orb1743186]
The human full length GCGR protein has a MW of 54.0 kDa
Mammalian
10 μg, 50 μg, 100 μgHuman GCGR Protein, hFc Tag [orb1290961]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 39.2 kDa after removal of the signal peptide. The apparent molecular mass of GCGR-hFc is approximately 55-70 kDa due to glycosylation.
Mammalian
50 μg, 10 μg, 100 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars