You have no items in your shopping cart.
Featured
Active
Description
Research Area
Cancer Biology
Images & Validation
−
Item 1 of 2
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized human GCGR at 2 μg/mL can bind Anti-GCGR recombinant antibody, the EC50 is 3.747-6.666 ng/mL. |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Expression Region | 26-136aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 18.1 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−(GL-R)
Similar Products
−
GCGR N-ECD Human Recombinant Protein (Biotin) [orb2992931]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. (QC verified)
Predicted: 15.5 KDa. Observed: 26-56 KDa, reducing conditions
20 μg, 100 μgRecombinant Human GCGR N-ECD Protein [orb2992951]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. (QC verified)
Predicted: 40 kDa. Observed: 47-75 kDa
500 μg, 1 mg, 10 μg, 50 μgRecombinant Human GCGR N-ECD Protein [orb2992955]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. (QC verified)
Predicted: 13.9 kDa. Observed: 24-50 kDa
10 μg, 50 μg, 500 μg, 1 mg- Item 1 of 2
- Item 1 of 2
Human GCGR full length protein-synthetic nanodisc [orb1743186]
Unconjugated
The human full length GCGR protein has a MW of 54.0 kDa
Mammalian
50 μg, 10 μg, 100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 4-5 weeks