You have no items in your shopping cart.
Featured
Description
Research Area
Cancer Biology
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Baculovirus |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Expression Region | 26-136aa |
| Protein Length | Partial |
| MW | 16.9 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−GL-R
Similar Products
−
GCGR N-ECD Human Recombinant Protein (Biotin) [orb2992931]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. (QC verified)
Predicted: 15.5 KDa. Observed: 26-56 KDa, reducing conditions
20 μg, 100 μgRecombinant Human GCGR N-ECD Protein [orb2992951]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. (QC verified)
Predicted: 40 kDa. Observed: 47-75 kDa
500 μg, 1 mg, 10 μg, 50 μgRecombinant Human GCGR N-ECD Protein [orb2992955]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. (QC verified)
Predicted: 13.9 kDa. Observed: 24-50 kDa
10 μg, 50 μg, 500 μg, 1 mg- Item 1 of 2
- Item 1 of 2
Human GCGR protein [orb605217]
Greater than 95% as determined by SDS-PAGE.
18.1 kDa
Mammalian cell
100 μg, 20 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-6 weeks