Human GCGR protein

Catalog Number: orb594980

Catalog Number	orb594980
Category	Proteins
Description	Recombinant Human Glucagon receptor(GCGR),partial
Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 85% as determined by SDS-PAGE.
MW	16.9 kDa
UniProt ID	P47871
Protein Sequence	AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK
Protein Length	Partial
Source	Baculovirus
Expression System	Expression Region: 26-136aa. Protein Length: Partial
Expression Region	26-136aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	GL-R Read more...
Note	For research use only
Application notes	Partial
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 39.2 kDa after removal of the signal peptide. The apparent molecular mass of GCGR-hFc is approximately 55-70 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 50 μg, 10 μg, 100 μg

Purity:	Greater than 85% as determined by SDS-PAGE.
MW:	20.5 kDa
Source:	E.coli

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	15.1 kDa
Source:	Yeast

Purity:	Greater than 95% as determined by SDS-PAGE.
MW:	18.1 kDa
Source:	Mammalian cell

MW:	The human full length GCGR protein has a MW of 54.0 kDa
Source:	Mammalian