You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb54116 |
---|---|
Category | Proteins |
Description | Recombinant human FGFR3 protein |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Protein Sequence | RLRSPPKKGLGSPTVHKISRFPLKRQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT |
Protein Length | Partial |
UniProt ID | P22607 |
MW | 47.4 kDa |
Application notes | N-terminal 6xHis-tagged: N-terminal 6xHis-tagged1-429AA: 397-806AAFull Length: Partial |
Endotoxins | Not test. |
Source | Yeast |
Biological Origin | Homo sapiens (Human) |
Expression Region | 397-806aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | CD_antigen, CD333 |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Greater than 90% as determined by SDS-PAGE. | |
40.1 kDa | |
Yeast |
Greater than 90% as determined by SDS-PAGE. | |
42.1 kDa | |
E.coli |
Greater than 95% as determined by SDS-PAGE. | |
64.8 kDa | |
Mammalian cell |
Greater than 90% as determined by SDS-PAGE. | |
59.4 kDa | |
E.coli |
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 39.0 kDa after removal of the signal peptide. The apparent molecular mass of FGFR3-His is approximately 55-70 kDa due to glycosylation. | |
Mammalian |