You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
Human FGFR3 protein
Catalog Number: orb245837
| Catalog Number | orb245837 |
|---|---|
| Category | Proteins |
| Description | Recombinant human Fibroblast growth factor receptor 3 |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG |
| Protein Length | Extracellular Domain |
| UniProt ID | P22607 |
| MW | 40.1 kDa |
| Application notes | This is His-tag protein |
| Endotoxins | Not test. |
| Source | Yeast |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 23-375aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | FGFR3 |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) FGFR3.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) FGFR3.
- Item 1 of 1
Human FGFR3 protein [orb244208]
Greater than 90% as determined by SDS-PAGE.
42.1 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Human FGFR3 protein [orb594741]
Greater than 95% as determined by SDS-PAGE.
64.8 kDa
Mammalian cell
10 μg, 50 μg, 1 mg, 500 μg - Item 1 of 1
Human FGFR3 protein [orb54116]
Greater than 90% as determined by SDS-PAGE.
47.4 kDa
Yeast
1 mg, 20 μg, 100 μg - Item 1 of 1
Human FGFR3 protein [orb54587]
Greater than 90% as determined by SDS-PAGE.
59.4 kDa
E.coli
20 μg, 1 mg, 100 μg - Item 1 of 1
Human FGFR3 Protein, His Tag [orb1291775]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 39.0 kDa after removal of the signal peptide. The apparent molecular mass of FGFR3-His is approximately 55-70 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μg
