You have no items in your shopping cart.
Cart summary
Human FCER2 Protein
Catalog Number: orb1478119
| Catalog Number | orb1478119 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Low affinity immunoglobulin epsilon Fc receptor(FCER2),partial |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| MW | 49.9 kDa |
| UniProt ID | P06734 |
| Protein Sequence | DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPG |
| Protein Length | Partial |
| Source | E.coli |
| Expression System | Expression Region: 48-248aa. Protein Length: Partial |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | (BLAST-2)(C-type lectin domain family 4 member J)( Read more... |
| Note | For research use only |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
Human FCER2 protein [orb624109]
Greater than 85% as determined by SDS-PAGE.
33.2 kDa
Mammalian cell
20 μg, 100 μg, 1 mgHuman FCER2 protein [orb244202]
Greater than 90% as determined by SDS-PAGE.
47 kDa
E.coli
20 μg, 100 μg, 1 mgHuman FCER2 protein [orb706856]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgHuman FCER2 Protein [orb1478086]
Greater than 90% as determined by SDS-PAGE.
27.3 kDa
E.coli
20 μg, 100 μg, 1 mgRecombinant Human CD23/FCER2 Protein, His Tag [orb1553445]
≥90% as determined by SDS-PAGE
This protein contains the human FCER2(Asp48-Ser321) was fused with the N-terminal His Tag and expressed in Mammalian cells.
100 μg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
