You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human FCER2 protein
Catalog Number: orb244202
| Catalog Number | orb244202 |
|---|---|
| Category | Proteins |
| Description | Recombinant human Low affinity immunoglobulin epsilon Fc receptor |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 47 kDa |
| UniProt ID | P06734 |
| Protein Sequence | DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS |
| Protein Length | Extracellular Domain |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 48-321aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | FCER2 Read more... |
| Note | For research use only |
| Application notes | Full length of Extracellular of His-SUMO-tag and expression region is 48-321aa |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
- Item 1 of 1
Human FCER2 protein [orb624109]
Greater than 85% as determined by SDS-PAGE.
33.2 kDa
Mammalian cell
20 μg, 100 μg, 1 mg - Item 1 of 2
Recombinant human CD23 / Fc Epsilon RII protein, N-His (HEK293) [orb1516500]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 38-45 kDa based on Tris-Bis PAGE result.
100 μg, 50 μg 
Human FCER2 protein [orb706856]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
10 μg, 50 μg, 500 μg- Item 1 of 1
Human FCER2 Protein [orb1478086]
Greater than 90% as determined by SDS-PAGE.
27.3 kDa
E.coli
1 mg, 20 μg, 100 μg
