You have no items in your shopping cart.
Human EGFP protein
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Human cytomegalovirus (HHV-5) (Human herpesvirus 5) |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Molecular Weight | 30.9 kDa |
| Expression Region | 1-239aa |
| Protein Length | Full Length |
| Protein Sequence | MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human CD20 (Fluorescent VLP, Full Length) [orb2992844]
SEC-HPLC: Greater than 95% as determined by SEC-HPLC. (QC verified)
Predicted: 35.1 KDa
100 μg, 20 μgHuman GPRC5D (Fluorescent VLP, Full Length) [orb2992905]
SEC-HPLC: Greater than 95% as determined by SEC-HPLC.(QC verified)
Predicted: 39.8 KDa
100 μg, 20 μgHuman Claudin-9 (Fluorescent VLP, Full Length) [orb2992895]
SEC-HPLC: Greater than 90% as determined by SEC-HPLC.(QC verified)
Predicted: 49.8 KDa
500 μg, 100 μg, 20 μgFluorescent Human CLDN18.2 Full Length Protein-VLP (EGFP) [orb1471702]
The human full length CLDN18.2 fusion protein has a MW of 54.2 kDa
Mammalian
100 T, 25 TRecombinant Human cytomegalovirus Enhanced green fluorescent protein (egfp) [orb1674632]
Greater than 90% as determined by SDS-PAGE.
28.4 kDa
Yeast
1 mg, 100 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human EGFP protein (orb418835)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review


