Human CXCR4 protein

• Catalog Number: orb9925
• Category: Proteins
• Description: Recombinant of human CXCR4 protein
• Tag: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
• Form/Appearance: Liquid or Lyophilized powder
• Purity: Greater than 90% as determined by SDS-PAGE.
• MW: 25.2 kDa
• UniProt ID: P61073
• Protein Sequence: PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS
• Protein Length: Partial of Isoform 2
• Source: E.coli
• Expression System: Expression Region: 303-352aa. Protein Length: Partial of Isoform 2
• Expression Region: 303-352aa
• Endotoxins: Not test.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Alternative names: FB22 Fusin HM89 LCR1 Leukocyte-derived seven trans
• Note: For research use only
• Application notes: Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 303-352aaSequence Info: Partial Glycerol content: 0.5
• Expiration Date: 6 months from date of receipt.