You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594713 |
---|---|
Category | Proteins |
Description | Recombinant Human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha(CSF2RA),partial (Active) |
Tag | C-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
Purity | Greater than 95% as determined by SDS-PAGE. |
Protein Sequence | EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG |
Protein Length | Partial |
UniProt ID | P15509 |
MW | 35.5 kDa |
Application notes | Partial |
Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Source | Mammalian cell |
Biological Origin | Homo sapiens (Human) |
Biological Activity | The ED50 as determined by its ability to inhibit GM-CSF-dependent proliferation of TF‑1 human erythroleukemic cells is 0.5-2 μg/ml. |
Expression Region | 23-320aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | Granulocyte-Macrophage Colony-Stimulating Factor R Read more... |
Research Area | Immunology & Inflammation |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Greater than 90% as determined by SDS-PAGE. | |
50.5 kDa | |
E.coli |
>95% as determined by Tris-Bis PAGE; >95% as determined by SEC-HPLC | |
Due to glycosylation, the protein migrates to 68-75 kDa based on Tris-Bis PAGE result. |
>95% as determined by Tris-Bis PAGE; >95% as determined by SEC-HPLC | |
Due to glycosylation, the protein migrates to 68-75 kDa based on Tris-Bis PAGE result. |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
> 95% by SDS-PAGE. | |
Recombinant Human GM-CSF R alpha/CSF2RA Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Glu23-Gly320) of human GM-CSF R alpha/CSF2RA (Accession #P15509) fused with a 6��His Tag at the C-terminus. |