You have no items in your shopping cart.
Page Not Found
Cart summary
Item 1 of 1
Human CSF2RA protein
Catalog Number: orb244135
| Catalog Number | orb244135 |
|---|---|
| Category | Proteins |
| Description | Recombinant human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG |
| Protein Length | Extracellular Domain |
| UniProt ID | P15509 |
| MW | 50.5 kDa |
| Application notes | Full length of Extracellular of His-SUMO-tag and expression region is 23-320aa |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 23-320aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | CSF2RA |
| Research Area | Immunology & Inflammation |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human CSF2RA protein [orb594713]
Greater than 95% as determined by SDS-PAGE.
35.5 kDa
Mammalian cell
1 mg, 500 μg, 10 μg, 50 μg - Item 1 of 2
Recombinant human GM-CSF R Alpha protein, C-His-Avi (HEK293) [orb1516470]
>95% as determined by Tris-Bis PAGE; >95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 68-75 kDa based on Tris-Bis PAGE result.
100 μg - Item 1 of 2
Recombinant human GM-CSF R Alpha protein, C-His-Avi (HEK293), Biotin conjugated [orb2328762]
>95% as determined by Tris-Bis PAGE; >95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 68-75 kDa based on Tris-Bis PAGE result.
20 μg 
Human CSF2RA protein [orb391541]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
10 μg, 50 μg, 500 μgRecombinant Human GM-CSF R alpha/CSF2RA Protein, His Tag [orb1550763]
> 95% by SDS-PAGE.
Recombinant Human GM-CSF R alpha/CSF2RA Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Glu23-Gly320) of human GM-CSF R alpha/CSF2RA (Accession #P15509) fused with a 6��His Tag at the C-terminus.
50 μg
