Cart summary

You have no items in your shopping cart.

RecombinantCT-1,Human

RecombinantCT-1,Human

Catalog Number: orb1494756

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1494756
CategoryProteins
DescriptionCardiotrophin-1 (CT-1) is a member of the cytokine family which also includes IL-6, IL-11, l LIF, CNTF, OSM. CT-1 has since been shown to be a pleiotrophic cytokine with overlapping actions with other IL-6 family members on a variety of cell types. Biologically active human CT-1 is synthesized as a 201 amino acid polypeptide lacking a hydrophobic N-terminal secretion signal sequence. Recombinant Human CT-1 is a 21.1 kDa protein consisting of 200 amino acid residues.
Form/AppearanceLyophilized after extensive dialysis against PBS.
Buffer/PreservativesLyophilized after extensive dialysis against PBS.
Purity> 95% as analyzed by SDS-PAGE.
Protein SequenceSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGL PVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASA ASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA
MW24~26kDa, observed by reducing SDS-PAGE.
Application notesReconstituted in ddH2O or PBS at 100 μg/ml.
Endotoxins< 0.2 EU/μg, determined by LAL method.
SourceCHO
Biological ActivityED50 < 0.4 ng/ml, measured in a cell proliferation assay using TF-1 cells.
StorageLyophilized recombinant Human Cardiotrophin-1°CT-1) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Cardiotrophin-1°CT-1) should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Alternative namesCT1
NoteFor research use only