You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb624085 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human C-type lectin domain family 4 member C protein |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0 |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI |
| Protein Length | Partial |
| UniProt ID | Q8WTT0 |
| MW | 36 kDa |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized CLEC4C protein at 1 μg/ml can bind human CLEC4C antibody, the EC50 of human CLEC4C antibody is 31.43-43.52 μg/ml. |
| Expression Region | 45-213aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Blood dendritic cell antigen 2 ;BDCA-2;C-type lect Read more... |
| Research Area | Immunology & Inflammation |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized CLEC4C protein at 1 μg/ml can bind human CLEC4C antibody, the EC50 of human CLEC4C antibody is 31.43-43.52 μg/ml.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CLEC4C.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CLEC4C.
Greater than 90% as determined by SDS-PAGE. | |
24 kDa | |
Mammalian cell |
Greater than 90% as determined by SDS-PAGE. | |
22 kDa | |
Yeast |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 46.1 kDa after removal of the signal peptide. The apparent molecular mass of hFc-CLEC4C is approximately 55-70 kDa due to glycosylation. | |
Mammalian |
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 20.8 kDa after removal of the signal peptide. The apparent molecular mass of CLEC4C-His is approximately 25-35 kDa due to glycosylation. | |
E.coli |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review