You have no items in your shopping cart.
Human CLEC4C protein
SKU: orb358925
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-tagged |
| Molecular Weight | 24 kDa |
| Expression Region | 45-213aa |
| Protein Length | Extracellular Domain |
| Protein Sequence | NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxins | Not test. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 6 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Disclaimer | For research use only |
Alternative Names
−Blood dendritic cell antigen 2 Short name, BDCA-2 C-type lectin superfamily member 7 Dendritic lectin CD_antigen, CD303
Similar Products
−- Item 1 of 4
Human CLEC4C protein [orb624085]
Greater than 90% as determined by SDS-PAGE.
36 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 2
- Item 1 of 1
Human CLEC4C protein [orb383167]
Greater than 90% as determined by SDS-PAGE.
22 kDa
Yeast
1 mg, 20 μg, 100 μg - Item 1 of 1
Human CLEC4C Protein, hFc Tag [orb1290922]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 46.1 kDa after removal of the signal peptide. The apparent molecular mass of hFc-CLEC4C is approximately 55-70 kDa due to glycosylation.
Mammalian
50 μg, 10 μg, 100 μg 
Recombinant Human CD303/CLEC4C Protein, N-His [orb2967560]
>90% as determined by SDS-PAGE.
19.46 kDa
1 mg, 100 μg, 50 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
SDS-PAGE analysis of Human CLEC4C protein
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human CLEC4C protein (orb358925)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks