Human CLEC4C protein

Catalog Number: orb358925

Catalog Number	orb358925
Category	Proteins
Description	Recombinant human CLEC4C protein
Tag	N-terminal 6xHis-Myc-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	24 kDa
UniProt ID	Q8WTT0
Protein Sequence	NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
Protein Length	Extracellular Domain
Source	Mammalian cell
Expression System	Expression Region: 45-213aa. Protein Length: Extracellular Domain
Expression Region	45-213aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	Blood dendritic cell antigen 2 Short name, BDCA-2 Read more...
Note	For research use only
Application notes	Full length of HIS-tag and expression region is 26.79kDa
Expiration Date	6 months from date of receipt.

SDS-PAGE analysis of Human CLEC4C protein

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 20.8 kDa after removal of the signal peptide. The apparent molecular mass of CLEC4C-His is approximately 25-35 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 100 μg, 50 μg, 10 μg

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 46.1 kDa after removal of the signal peptide. The apparent molecular mass of hFc-CLEC4C is approximately 55-70 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 50 μg, 10 μg, 100 μg

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	22 kDa
Source:	Yeast

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	36 kDa
Source:	E.coli

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the human CLEC4C(Asn45-IIe213) was fused with the C-terminal His Tag and expressed in Mammalian cells.