Human CD8A protein

Catalog Number: orb358935

Catalog Number	orb358935
Category	Proteins
Description	Recombinant human CD8A protein
Tag	N-terminal 6xHis-Myc-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	21.6 kDa
UniProt ID	P01732
Protein Sequence	SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
Protein Length	Extracellular Domain
Source	Mammalian cell
Expression System	Expression Region: 22-182aa. Protein Length: Extracellular Domain
Expression Region	22-182aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	T-lymphocyte differentiation antigen T8/Leu-2 CD_a Read more...
Note	For research use only
Application notes	Full length of HIS-tag and expression region is 21.81kDa
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	95%
MW:	48.6 kDa
Source:	Human LILRB2, His Tag (orb257669) is expressed from human 293 cells (HEK293). It contains AA Gln 22 - Val 461 (Accession # AAH36827).

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	19.6 kDa
Source:	Yeast

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	33.6 kDa
Source:	E.coli

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the human CD8A(Met1-Asp182) was fused with the C-terminal His Tag and expressed in Mammalian cells.