You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb358935 |
---|---|
Category | Proteins |
Description | Recombinant human CD8A protein |
Tag | N-terminal 6xHis-Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 21.6 kDa |
UniProt ID | P01732 |
Protein Sequence | SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD |
Protein Length | Extracellular Domain |
Source | Mammalian cell |
Expression System | Expression Region: 22-182aa. Protein Length: Extracellular Domain |
Expression Region | 22-182aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | T-lymphocyte differentiation antigen T8/Leu-2 CD_a Read more... |
Note | For research use only |
Application notes | Full length of HIS-tag and expression region is 21.81kDa |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
48.6 kDa | |
Human LILRB2, His Tag (orb257669) is expressed from human 293 cells (HEK293). It contains AA Gln 22 - Val 461 (Accession # AAH36827). |
Greater than 90% as determined by SDS-PAGE. | |
19.6 kDa | |
Yeast |
Greater than 90% as determined by SDS-PAGE. | |
33.6 kDa | |
E.coli |
≥90% as determined by SDS-PAGE | |
This protein contains the human CD8A(Met1-Asp182) was fused with the C-terminal His Tag and expressed in Mammalian cells. |
Filter by Rating