Cart summary

You have no items in your shopping cart.

Human CCL25 protein (Active)

Catalog Number: orb359082

DispatchUsually dispatched within 1-2 weeks
$ 2,546.00
Catalog Numberorb359082
CategoryProteins
DescriptionRecombinant human CCL25 active protein
TagTag-Free
Form/AppearanceLyophilized powder
Purity> 97% as determined by SDS-PAGE and HPLC.
MW14.3 kDa
UniProt IDO15444
Protein SequenceM+QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL
Protein LengthFull Length of Mature Protein
SourceE.Coli
Expression System24-150aa
Biological ActivityFully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 1.0-10 ng/ml.
Expression Region24-150aa
EndotoxinsLess than 1.0 EU/µg as determined by LAL method.
StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/PreservativesLyophilized from a 0.2 µm filtered PBS, pH 7.4
Alternative namesChemokine TECK, Thymus-expressed chemokine
Read more...
NoteFor research use only
Application notesWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Expiration Date6 months from date of receipt.
Human CCL25 protein (Active)

SDS-PAGE analysis of Human CCL25 protein (Active)

Human CCL25 protein (Active)

Submit a review

Filter by Rating

    • Star
    • Star
    • Star
    • Star
    • Star
    • 5 stars
    • Star
    • Star
    • Star
    • Star
    • Star
    • 4 stars
    • Star
    • Star
    • Star
    • Star
    • Star
    • 3 stars
    • Star
    • Star
    • Star
    • Star
    • Star
    • 2 stars
    • Star
    • Star
    • Star
    • Star
    • Star
    • 1 stars