Cart summary

You have no items in your shopping cart.

Human CCL16 Protein

SKU: orb168049

Description

Recombinant of Human CCL16 protein

Images & Validation

Application Notes
Chemokines

Key Properties

SourceEscherichia Coli
Biological ActivityDetermined by its ability to chemoattract total human monocytes using a concentration range of 10-100 ng/ml corresponding to a Specific Activity of 10,000-100,000IU/mg.
Protein SequenceQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNP NDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
PurityGreater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.

Storage & Handling

StorageStability: Lyophilized CCL16 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL16 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
Form/AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
Buffer/PreservativesThe CCL16 protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

C-C motif chemokine 16, Small-inducible cytokine A16, IL-10-inducible chemokine, Chemokine LEC, Monotactin-1, Chemokine CC-4, Lymphocyte and monocyte chemoattractant, CCL-16, HCC-4, HCC4, NCC4, NCC-4, Liver Expressed Chemokine, LMC, LCC-1, LCC1, MTN-1, MTN1, SCYL4, ckB12, SCYA16, LEC, ILINCK, MGC117051.

Similar Products

  • Human CCL16 protein (Active) [orb359044]

    > 97% as determined by SDS-PAGE and HPLC.

    11.2 kDa

    E.Coli

    5 μg, 100 μg, 500 μg
  • Human CCL16 protein [orb244076]

    Greater than 90% as determined by SDS-PAGE.

    27.2 kDa

    E.coli

    20 μg, 100 μg, 1 mg
  • Recombinant Human CCL16/HCC-4 Protein, N-GST [orb2969946]

    >90% as determined by SDS-PAGE.

    38.03 kDa

    1 mg, 100 μg, 50 μg
  • Human CCL16 Protein [orb1471709]

    Unconjugated

    The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.

    11 KDa

    Mammalian

    10 μg, 50 μg
  • CCL16 Antibody [orb239425]

    ELISA

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Human CCL16 Protein (orb168049)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
$ 250.00
20 μg
$ 350.00
1 mg
$ 3,620.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry