Human CCL16 protein

Catalog Number: orb244076

Catalog Number	orb244076
Category	Proteins
Description	Recombinant human C-C motif chemokine 16
Tag	N-terminal 6xHis-SUMO-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	27.2 kDa
UniProt ID	O15467
Protein Sequence	QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
Protein Length	Full Length of Mature Protein
Source	E.coli
Expression System	Expression Region: 24-120aa. Protein Length: Full Length of Mature Protein
Expression Region	24-120aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	CCL16 Read more...
Note	For research use only
Application notes	Full length of His-SUMO-tag and expression region is 24-120aa
Expiration Date	6 months from date of receipt.

Purity:	> 97% as determined by SDS-PAGE and HPLC.
MW:	11.2 kDa
Source:	E.Coli

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Source:	E. coli

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	11 KDa
Source:	E. Coli

Applications:	SDS-PAGE
Conjugation:	Unconjugated
Purity:	> 97.0% as determined by RP-HPLC and analysis by SDS-PAGE

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the human CCL16(Gln24-Gln120) was fused with the N-terminal His Tag and expressed in E. coli.