Cart summary

You have no items in your shopping cart.

Human BMP 2 Protein

Human BMP 2 Protein

Catalog Number: orb167991

DispatchUsually dispatched within 5-10 working days
$ 250.00
Catalog Numberorb167991
CategoryProteins
DescriptionRecombinant of Human BMP 2 protein
Form/AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
Buffer/PreservativesThe BMP2 was lyophilized from 0.67mg/ml in 2xPBS + 6% ethanol.
PurityGreater than 95.0% as determined by analysis by SDS-PAGE.
Protein SequenceQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNST NHAIVQTLVNSVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
Application notesCytokines And Growth Factors
SourceHEK
Biological ActivityThe specific activity as determined by the dose dependent induction of alkaline phosphatase production in the ATDC-5 cell line (Mouse chondrogenic cell line) was found to be 6.53ng/ml.
Solubility (25°C)It is recommended to reconstitute the lyophilized BMP-2 in sterile 4mM HCl containing 0.1% endotoxin-free recombinant HSA.
StorageStability: Lyophilized BMP2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP-2 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
Alternative namesBMP-2, BMP2A.
NoteFor research use only
  • Anti-HDAC2 Antibody [orb763049]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    10 μg, 100 μg
  • Human BMP2 protein (Active) [orb359186]

    > 95% as determined by SDS-PAGE and HPLC.

    13 kDa

    E.Coli

    10 μg, 100 μg, 500 μg
  • Human BMP-2 Protein [orb257227]

    Unconjugated

    95%

    12.8 kDa

    20 μg, 1 mg, 200 μg
  • Recombinant human BMP-2 protein, N-His [orb86211]

    > 95% as determined by SDS-PAGE

    17 kDa

    10 μg, 500 μg, 100 μg
  • Human BMP2 protein [orb603938]

    Greater than 90% as determined by SDS-PAGE.

    16.9 kDa

    E.coli

    100 μg, 20 μg, 1 mg