Cart summary

You have no items in your shopping cart.

Human BMP 2 Protein

SKU: orb167991

Description

Recombinant of Human BMP 2 protein

Images & Validation

Application Notes
Cytokines And Growth Factors

Key Properties

SourceHEK
Biological ActivityThe specific activity as determined by the dose dependent induction of alkaline phosphatase production in the ATDC-5 cell line (Mouse chondrogenic cell line) was found to be 6.53ng/ml.
Protein SequenceQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNST NHAIVQTLVNSVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
PurityGreater than 95.0% as determined by analysis by SDS-PAGE.

Storage & Handling

StorageStability: Lyophilized BMP2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP-2 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
Form/AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
Buffer/PreservativesThe BMP2 was lyophilized from 0.67mg/ml in 2xPBS + 6% ethanol.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

BMP-2, BMP2A.

Similar Products

  • GREM2 Antibody [orb676411]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • Human BMP-2 Protein [orb257227]

    Unconjugated

    95%

    12.8 kDa

    20 μg, 1 mg, 200 μg
  • Human Bone Morphogenetic Protein 2 (BMP2) ELISA Kit [orb775268]

    Human

    15.63-1000 pg/mL

    6.1 pg/mL

    96 T, 48 T
  • Human BMP Binding Endothelial Regulator (BMPER) ELISA Kit [orb777434]

    Human

    0.16-10 ng/mL

    0.056 ng/mL

    96 T, 48 T
  • Human Gremlin 1 (GREM1) ELISA Kit [orb776964]

    Human

    125-8000 pg/mL

    55 pg/mL

    96 T, 48 T
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Human BMP 2 Protein (orb167991)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

2 μg
$ 250.00
10 μg
$ 350.00
100 μg
$ 1,700.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry