Human BID protein

SKU: orb244046

Description

This Human BID protein spans the amino acid sequence from region 1-195aa. Purity: Greater than 90% as determined by SDS-PAGE.

Images & Validation

• Application Notes:
  Full length of His-SUMO-tag and expression region is 1-195aa

Key Properties

• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Tag: N-terminal 6xHis-SUMO-tagged
• Molecular Weight: 38 kDa
• Expression Region: 1-195aa
• Protein Length: Full Length
• Protein Sequence: MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
• Purity: Greater than 90% as determined by SDS-PAGE.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Disclaimer: For research use only

Alternative Names

Apoptic death agonist protein, BH3 interacting domain death agonist protein, BH3 interacting domain death agonist p11 protein, BH3 interacting domain death agonist p13 protein, BH3 interacting domain death agonist p15 protein, BH3-interacting domain death agonist p11 protein, BID protein, BID isoform ES(1b) protein, BID isoform L(2) protein, BID isoform Si6 protein, Desmocollin type 4 protein, FP497 protein, p11 BID protein, p13 BID protein, p15 BID protein, p22 BID protein

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

P55957