You have no items in your shopping cart.
Human BID protein
SKU: orb244046
Featured
Description
Research Area
Cell Biology
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Molecular Weight | 38 kDa |
| Expression Region | 1-195aa |
| Protein Length | Full Length |
| Protein Sequence | MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Disclaimer | For research use only |
Alternative Names
−Apoptic death agonist protein, BH3 interacting domain death agonist protein, BH3 interacting domain death agonist p11 protein, BH3 interacting domain death agonist p13 protein, BH3 interacting domain death agonist p15 protein, BH3-interacting domain death agonist p11 protein, BID protein, BID isoform ES(1b) protein, BID isoform L(2) protein, BID isoform Si6 protein, Desmocollin type 4 protein, FP497 protein, p11 BID protein, p13 BID protein, p15 BID protein, p22 BID protein
Similar Products
−BID Antibody [KO/KD Validated] [orb1473850]
IF, IHC, WB
Human
Mouse
Monoclonal
Unconjugated
30 μl, 50 μl, 200 μl, 100 μlBID (Phospho-S78) Antibody [orb382717]
IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human BID protein (orb244046)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review![BID Antibody [KO/KD Validated]](/images/pub/media/catalog/product/NewWebsite/16/orb1473850_1.jpg)
![BID Antibody [KO/KD Validated]](/images/pub/media/catalog/product/NewWebsite/16/orb1473850_2.jpg)
![BID Antibody [KO/KD Validated]](/images/pub/media/catalog/product/NewWebsite/16/orb1473850_3.jpg)







