You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb603933 |
---|---|
Category | Proteins |
Description | Recombinant Human Brain-derived neurotrophic factor(BDNF),partial |
Tag | N-terminal GST-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 38.5 kDa |
UniProt ID | P23560 |
Protein Sequence | ELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSC |
Protein Length | Partial |
Source | E.coli |
Expression System | Expression Region: 137-237aa. Protein Length: Partial |
Expression Region | 137-237aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Abrineurin Read more... |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
13.5 kDa | |
Human BDNF, premium grade (orb1675341) is expressed from human 293 cells (HEK293). It contains AA His 129 - Arg 247 (Accession # P23560-1). |
Unconjugated | |
95% | |
45.2 kDa | |
Human TrkB, His Tag (orb257719) is expressed from human 293 cells (HEK293). It contains AA Cys 32 - His 430 (Accession # AAH31835). |
Unconjugated | |
98% | |
70.4 kDa | |
Human TrkB, Fc Tag (orb257720) is expressed from human 293 cells (HEK293). It contains AA Cys 32 - His 430 (Accession # AAH31835). |
Greater than 90% as determined by SDS-PAGE. | |
29.5 kDa | |
E.coli |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | |
Human cells |
Filter by Rating