Human BDNF protein

• Catalog Number: orb594732
• Category: Proteins
• Description: Recombinant Human Brain-derived neurotrophic factor(BDNF) (Active)
• Tag: Tag-Free
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM PB, 250 mM NaCl, pH 7.2
• Purity: Greater than 95% as determined by SDS-PAGE.
• Protein Sequence: HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
• Protein Length: Full Length of Mature Protein
• UniProt ID: P23560
• MW: 13 kDa
• Application notes: Full Length of Mature Protein
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human TrkB (C-6His) at 5 μg/mL can bind Human BDNF, Biotinylated by NHS-biotin prior to testing, the EC50 of Human BDNF is ≤20 ng/mL.
• Expression Region: 129-247aa
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Alternative names: Brain-Derived Neurotrophic Factor; BDNF; Abrineuri
• Research Area: Neuroscience
• Note: For research use only

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.