You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb424263 |
---|---|
Category | Proteins |
Description | Recombinant of human BCA-1 protein |
Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
Buffer/Preservatives | The BCA-1 protein was lyophilized from a concentrated (0.5mg/ml) solution containing 20mM PBS & 150mM NaCl pH-7.4. |
Purity | Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Protein Sequence | VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNG CPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKR SSSTLPVPVFKRKIP |
Application notes | Chemokines |
Source | Escherichia Coli |
Biological Activity | Determined by its ability to chemoattract human B cells using a concentration range of 1-10ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg. |
Solubility (25°C) | It is recommended to reconstitute the lyophilized CXCL13 in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Storage | Stability: Lyophilized BCA1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BCA1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
Alternative names | C-X-C motif chemokine 13, Small-inducible cytokine Read more... |
Note | For research use only |
> 97% as determined by SDS-PAGE and HPLC. | |
10.3 kDa | |
E.Coli |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 36.4 kDa after removal of the signal peptide.The apparent molecular mass of hFc-CXCL13 is approximately 35-40 kDa due to glycosylation. | |
Mammalian |
Greater than 85.0% as determined by SDS-PAGE. | |
Escherichia Coli |