Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Human BCA-1 Protein

SKU: orb424263

Description

Recombinant of human BCA-1 protein

Research Area

Immunology & Inflammation

Images & Validation

Application Notes
Chemokines

Key Properties

SourceEscherichia Coli
Biological ActivityDetermined by its ability to chemoattract human B cells using a concentration range of 1-10ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg.
PurityGreater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Protein SequenceVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNG CPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKR SSSTLPVPVFKRKIP

Storage & Handling

StorageStability: Lyophilized BCA1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BCA1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
Form/AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
Buffer/PreservativesThe BCA-1 protein was lyophilized from a concentrated (0.5mg/ml) solution containing 20mM PBS & 150mM NaCl pH-7.4.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

C-X-C motif chemokine 13, Small-inducible cytokine B13, B lymphocyte chemoattractant, CXC chemokine BLC, CXCL13, BCA1, BCA-1, CXCL-13, B cell Attracting Chemokine-1, BLC, ANGIE, BLR1L, SCYB13, ANGIE2.

Similar Products

  • Human CXL13 protein (Active) [orb359061]

    > 97% as determined by SDS-PAGE and HPLC.

    10.3 kDa

    E.Coli

    500 μg, 100 μg, 5 μg
  • CXCL13/BCA-1/BLC Mouse Recombinant Antibody [orb2974637]

    ELISA,  FC,  NeA,  WB

    Human

    Mouse

    Monoclonal

    Unconjugated

    100 μg
  • Human CXCL13 Protein, hFc Tag [orb1291001]

    Unconjugated

    The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.

    The protein has a predicted molecular mass of 36.4 kDa after removal of the signal peptide.The apparent molecular mass of hFc-CXCL13 is approximately 35-40 kDa due to glycosylation.

    Mammalian

    100 μg, 10 μg, 50 μg
  • Human BCA-1/CXCL13 Recombinant Protein [orb1906077]

    > 97 % by SDS-PAGE and HPLC analyses.

    Approximately 10.3 kDa, a single non-glycosylated polypeptide chain containing 87 amino acids.

    5 μg, 100 μg, 500 μg
  • CXCL13/BLC/BCA-1 Human Antibody [orb2977287]

    ELISA,  FA,  FACS,  In vivo

    Human

    Human

    Monoclonal

    Unconjugated

    100 μg, 1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

5 μg
$ 250.00
20 μg
$ 350.00
1 mg
$ 3,620.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry