You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1494993 |
---|---|
Category | Proteins |
Description | CXCL13, also known as B-lymphocyte chemoattractant (BLC), is a CXC chemokine that is constitutively expressed in secondary lymphoid organs. BCA-1 cDNA encodes a protein of 109 amino acid residues with a leader sequence of 22 residues. Mature human BCA-1 shares 64% amino acid sequence similarity with the mouse protein and 23 - 34% amino acid sequence identity with other known CXC chemokines. Recombinant or chemically synthesized BCA-1 is a potent chemoattractant for B lymphocytes but not T lymphocytes, monocytes or neutrophils. BLR1, a G protein-coupled receptor originally isolated from Burkitt’s lymphoma cells, has now been shown to be the specific receptor for BCA-1. Among cells of the hematopoietic lineages, the expression of BLR1, now designated CXCR5, is restricted to B lymphocytes and a subpopulation of T helper memory cells. Mice lacking BLR1 have been shown to lack inguinal lymph nodes. These mice were also found to have impaired development of Peyer’s patches and defective formation of primary follicles and germinal centers in the spleen as a result of the inability of B lymphocytes to migrate into B cell areas |
Form/Appearance | Lyophilized from a 0.2m filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl. |
Buffer/Preservatives | Lyophilized from a 0.2m filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl. |
Purity | > 97% by SDS-PAGE and HPLC analyses. |
Protein Sequence | VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP |
MW | 10.3 kDa, a single non-glycosylated polypeptide chain containing 87 amino acids. |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions. |
Endotoxins | Less than 1EU/g of rHuBCA-1/CXCL13 as determined by LAL method. |
Source | Escherichia coli. |
Biological Activity | Measured by its ability to chemoattract human CXCR5 transfected BaF3 mouse pro-B cells.The ED50 for this effect is typically 0.005-0.02 μg/mL, corresponding to a Specific Activity of >5 x 104 IU/mg. |
Storage | This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles. |
Note | For research use only |