Human B7H4 protein

• Catalog Number: orb605018
• Category: Proteins
• Description: Recombinant Human V-set domain-containing T-cell activation inhibitor 1(B7H4),partial
• Tag: N-terminal 6xHis-tagged
• Form/Appearance: Liquid or Lyophilized powder
• Purity: Greater than 90% as determined by SDS-PAGE.
• MW: 29.6 kDa
• UniProt ID: Q7Z7D3
• Protein Sequence: IIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA
• Protein Length: Partial
• Source: E.coli
• Expression System: Expression Region: 26-258aa. Protein Length: Partial
• Expression Region: 26-258aa
• Endotoxins: Not test.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Alternative names: B7 homolog 4 , B7-H4B7h.5Immune costimulatory prot
• Note: For research use only
• Application notes: Partial
• Expiration Date: 6 months from date of receipt.