Human Acrp30 Protein

• Catalog Number: orb423944
• Category: Proteins
• Description: Recombinant of human Acrp30 protein
• Form/Appearance: Sterile Filtered clear solution.
• Buffer/Preservatives: Acrp30 protein solution contains Phosphate buffered saline pH 7.4 and 1mM DTT.
• Purity: Acrp30 purity is greater than 90% as determined by SDS-PAGE.
• Protein Sequence: MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
• Application notes: Cytokines And Growth Factors
• Source: Escherichia Coli
• Storage: Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles
• Alternative names: Acrp30, AdipoQ, GBP-28, APM-1, ACDC.
• Note: For research use only