Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 5-10 working days
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Human Acrp30 protein
Catalog Number orb423944
ReactivityHuman
ConjugationUnconjugated
Target Acrp30
Product Properties
Form/Appearance Sterile Filtered clear solution.
Acrp30 protein solution contains Phosphate buffered saline pH 7.4 and 1mM DTT.
Storage Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Note For research use only.
Protein Sequence MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN.
Purity >90% as determined by SDS-PAGE.
Source Escherichia Coli.
Product Description

Recombinant of human Acrp30 protein

Reviews
Write Your Own Review
You're reviewing:Human Acrp30 protein - orb423944
Your Rating