HTR3E Rabbit Polyclonal Antibody

• Catalog Number: orb324611
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HTR3E
• Target: HTR3E
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Canine, Equine, Rabbit
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HTR3E
• Protein Sequence: Synthetic peptide located within the following region: RWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPG
• UniProt ID: A5X5Y0
• MW: 53kDa
• Tested applications: ICC, IF, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti 5-HT3c1 antibody, anti MGC120035 antibody, an
• Note: For research use only
• NCBI: NP_872395

Immunofluorescence - Dilution: 1.3 ug/mL.

WB Suggested Anti-HTR3E Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human heart.