You have no items in your shopping cart.
HTR3A Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Mouse, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HTR3A |
| Target | HTR3A |
| Protein Sequence | Synthetic peptide located within the following region: LLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTV |
| Molecular Weight | 55 kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−5-HTR3 Rabbit Polyclonal Antibody [orb13227]
WB
Bovine, Canine, Gallus
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl, 200 μl5HT3A Receptor Rabbit Polyclonal Antibody [orb155533]
WB
Bovine, Canine, Equine, Porcine, Sheep
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlHTR3A Rabbit Polyclonal Antibody [orb627866]
ELISA, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment.

Sample Type: 721_B Whole Cell lysates, Antibody Dilution: 5 ug/ml.

Sample Type: RPMI-8226 lysates, Antibody Dilution: 1.0 ug/ml.

Human kidney

WB Suggested Anti-HTR3A Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.
Documents Download
Request a Document
Protocol Information
HTR3A Rabbit Polyclonal Antibody (orb592795)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review





