You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592795 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to HTR3A |
Target | HTR3A |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HTR3A |
Protein Sequence | Synthetic peptide located within the following region: LLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTV |
UniProt ID | P46098 |
MW | 55 kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | HTR3, 5HT3R, 5-HT-3, 5-HT3A, 5-HT3R |
Note | For research use only |
NCBI | NP_000860 |
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment.
Sample Type: 721_B Whole Cell lysates, Antibody Dilution: 5 ug/ml.
Sample Type: RPMI-8226 lysates, Antibody Dilution: 1.0 ug/ml.
Human kidney
WB Suggested Anti-HTR3A Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Gallus | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Porcine, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |