HTR3A Rabbit Polyclonal Antibody

• Catalog Number: orb592795
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HTR3A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HTR3A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 55 kDa
• Target: HTR3A
• UniProt ID: P46098
• Protein Sequence: Synthetic peptide located within the following region: LLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTV
• NCBI: NP_000860
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HTR3, 5HT3R, 5-HT-3, 5-HT3A, 5-HT3R
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/ml of the antibody was used in this experiment.

Sample Type: 721_B Whole Cell lysates, Antibody Dilution: 5 ug/ml.

Sample Type: RPMI-8226 lysates, Antibody Dilution: 1.0 ug/ml.

Human kidney

WB Suggested Anti-HTR3A Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.