HSPA4L Rabbit Polyclonal Antibody

• Catalog Number: orb330723
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HSPA4L
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HSPA4L
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 95kDa
• Target: HSPA4L
• UniProt ID: O95757
• Protein Sequence: Synthetic peptide located within the following region: KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEI
• NCBI: NP_055093
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti APG-1 antibody, anti Osp94 antibody, anti HSP
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

HSPA4L was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb330723 with 1:200 dilution. Western blot was performed using orb330723 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: HSPA4L IP with orb330723 in HEK293 Whole Cell Lysate. Lane 3: Input of HEK293 Whole Cell Lysate.

WB Suggested Anti-HSPA4L Antibody Titration: 0.2-1 ug/ml, Positive Control: Human brain.